StarFunc result for job id Q9NZP6

User Input

>input (1156 residues)
MGNLLSKFRPGCRRRPLPGPGRGAPAPLSRDASPPGRAHSVPTPRPFRGLFRRNARRRPS
AASIFVAPKRPCPLPRAAAAPLGVLPAVGWGLAIRKTPMLPARNPPRFGHPSSVRIPPPS
RMFTLLLPSPREPAVKARKPIPATLLEETEVWAQEGPRRVKKDEDPVQIEGEDDEKRTPL
SSGEASSTSRSQGTQGDVASFRCSPGPLEGNVYHKFSENSMSEKAQASPASSCLEGPAMP
STHSQAGCARHLGKPDPDATAPPEPAVGCSLLQQKLAAEVLNEEPPPSSLGLPIPLMSGK
RMPDEKPFCIPPRSAAPPRAARNRPCKRKMSIPLLLPLPPSLPLLWDRGELPPPAKLPCL
SVEGDLHTLEKSPEYKRNSRILEDKTETMTNSSITQPAPSFSQPVQTTDSLPLTTYTSQV
SAPLPIPDLADLATGPLILPIPPLSTTPKMDEKIAFTIPNSPLALPADLVPILGDQSNEK
GGSYNSVVGAAPLTSDPPTPPSSTPSFKPPVTRESPISMCVDSPPPLSFLTLLPVPSTGT
SVITSKPMNSTSVISTVTTNASAHLTSQTAVDPEVVNMDTTAPSQVVIFTSSLSSRVSSL
PNSQIHCSAEQRHPGKTSVYTSPLPFIFHNTTPSFNQLFGKEATPQPKFEAPDGQPQKAS
LPSACVFLSLPIIPPPDTSTLVNSASTASSSKPPIETNAMHTTPPSKAVILQSASVSKKY
LPFYLGLPGSGNTQPSGNTASVQGSTSLPAQSVRAPATASNHPLNPGATPQPKFGAPDGP
QQKTSLPSAHDFLSLPIMVPPDTSTLVSSASAASLSKPAIDTSDMNTTPPSKTVILQSTF
VSRKEEYIRFYMGLPGSGNTLHSDSIASAQVSTSFPAQADRRPTTTSSHPLNTGSISHST
LGATDGQQKSDSSFILGNPATPAPVIGLTSPSVQPLSGSIIPPGFAELTSPYTALGTPVN
AEPVEGHNASAFPNGTAKTSGFRIATGMPGTGDSTLLVGNTIPGPQVIMGPGTPMDGGSI
GFSMSAPGPSSTSGELNIGQGQSGTPSTTSVFPFGQAAWDPTGHSMAAAPQGASNIPVFG
YTSAAAYIPGLDPPTQNSCSGMGGDGTRSIVGGPCVPAFQQCILQHTWTERKFYTSSTHY
YGQETYVRRHVCFQLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZP6	0.999	0.999	0.000	1156	1.000	1.000	Q9NZP6.pdb.gz	NPAP1_HUMAN Nuclear pore-associated protein 1 OS=Homo sapiens OX=9606 GN=NPAP1 PE=1 SV=2
2	AFDB:Q96HA1	0.048	0.046	1.265E-6	1249	0.227	0.210	Q96HA1.pdb.gz	P121A_HUMAN Nuclear envelope pore membrane protein POM 121 OS=Homo sapiens OX=9606 GN=POM121 PE=1 SV=2
3	AFDB:P52591	0.036	0.035	9.281E-6	1199	0.218	0.210	P52591.pdb.gz	PO121_RAT Nuclear envelope pore membrane protein POM 121 OS=Rattus norvegicus OX=10116 GN=Pom121 PE=1 SV=1
4	AFDB:Q9VXE6	0.035	0.025	1.156E-2	1883	0.194	0.119	Q9VXE6.pdb.gz	NU153_DROME Nuclear pore complex protein Nup153 OS=Drosophila melanogaster OX=7227 GN=Nup153 PE=1 SV=4
5	AFDB:Q9BXM0	0.036	0.031	2.899E-2	1461	0.184	0.146	Q9BXM0.pdb.gz	PRAX_HUMAN Periaxin OS=Homo sapiens OX=9606 GN=PRX PE=1 SV=2
6	AFDB:Q9CAF4	0.037	0.033	2.899E-2	1309	0.182	0.160	Q9CAF4.pdb.gz	NUP1_ARATH Nuclear pore complex protein NUP1 OS=Arabidopsis thaliana OX=3702 GN=NUP1 PE=1 SV=1
7	AFDB:C4XZ24	0.043	0.028	5.778E-2	2164	0.194	0.104	C4XZ24.pdb.gz	FLO11_CLAL4 Flocculation protein FLO11 OS=Clavispora lusitaniae (strain ATCC 42720) OX=306902 GN=FLO11 PE=3 SV=1
8	AFDB:A0MSJ1	0.041	0.031	7.851E-2	1658	0.158	0.110	A0MSJ1.pdb.gz	CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio OX=7955 GN=col27a1b PE=2 SV=1
9	AFDB:F1M842	0.037	0.025	7.851E-2	1972	0.176	0.103	F1M842.pdb.gz	F1M842_RAT Tumor protein p53 binding protein 1 OS=Rattus norvegicus OX=10116 GN=Tp53bp1 PE=1 SV=3
10	AFDB:P49791	0.040	0.032	8.476E-2	1468	0.166	0.131	P49791.pdb.gz	NU153_RAT Nuclear pore complex protein Nup153 OS=Rattus norvegicus OX=10116 GN=Nup153 PE=1 SV=1
11	PDB:5jzwH	0.029	0.072	3.517E-1	401	0.004	0.012	5jzwH.pdb.gz
12	PDB:1jkiA	0.025	0.051	4.779E-1	525	0.002	0.004	1jkiA.pdb.gz	The crystal structure and mechanism of 1-L-myo-inositol- 1-phosphate synthase
13	PDB:6ahyB	0.027	0.085	4.779E-1	313	0.003	0.010	6ahyB.pdb.gz
14	PDB:1jkfA	0.026	0.060	5.159E-1	466	0.003	0.006	1jkfA.pdb.gz	The crystal structure and mechanism of 1-L-myo-inositol- 1-phosphate synthase
15	PDB:3b07B	0.033	0.121	6.493E-1	270	0.001	0.004	3b07B.pdb.gz
16	PDB:4f0aB	0.029	0.095	6.493E-1	294	0.004	0.017	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
17	PDB:1p1fA	0.024	0.053	7.568E-1	501	0.002	0.004	1p1fA.pdb.gz
18	PDB:3m3rC	0.031	0.103	9.524E-1	293	0.003	0.010	3m3rC.pdb.gz
19	PDB:3b07A	0.032	0.120	1.028	284	0.003	0.014	3b07A.pdb.gz
20	PDB:6sb3A	0.029	0.051	1.028	604	0.003	0.005	6sb3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NZP6	0.0	2301	1156	1.000	1.000	NPAP1_HUMAN Nuclear pore-associated protein 1 OS=Homo sapiens OX=9606 GN=NPAP1 PE=1 SV=2
2	A8CG34	4.85e-08	60.1	1229	0.119	0.111	P121C_HUMAN Nuclear envelope pore membrane protein POM 121C OS=Homo sapiens OX=9606 GN=POM121C PE=1 SV=3
3	P52591	2.23e-07	57.8	1199	0.076	0.073	PO121_RAT Nuclear envelope pore membrane protein POM 121 OS=Rattus norvegicus OX=10116 GN=Pom121 PE=1 SV=1
4	Q96HA1	4.15e-07	57.0	1249	0.053	0.049	P121A_HUMAN Nuclear envelope pore membrane protein POM 121 OS=Homo sapiens OX=9606 GN=POM121 PE=1 SV=2
5	Q3SYA9	0.001	45.4	428	0.024	0.065	P12L1_HUMAN Putative POM121-like protein 1 OS=Homo sapiens OX=9606 GN=POM121L1P PE=5 SV=2
6	Q6NN02	9.0	31.2	125	0.016	0.144	Y4445_ARATH Uncharacterized protein At4g14450, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At4g14450 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15229 POM121	1.4e-59	213.3	POM121 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333735

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433433	0.806	MAGE-like protein 2
2	9606.ENSP00000365630	0.772	Ras and EF-hand domain-containing protein
3	9606.ENSP00000313881	0.764	Probable E3 ubiquitin-protein ligase makorin-3
4	9606.ENSP00000303508	0.746	FERM domain-containing protein 3
5	9606.ENSP00000332643	0.744	Necdin
6	9606.ENSP00000382972	0.710	Small nuclear ribonucleoprotein-associated protein N
7	9606.ENSP00000365773	0.690	Phosphoserine aminotransferase
8	9606.ENSP00000300688	0.684	ATP synthase subunit g, mitochondrial
9	9606.ENSP00000365807	0.684	Guanine nucleotide-binding protein subunit alpha-14
10	9606.ENSP00000365720	0.665	Transducin-like enhancer protein 4
11	9606.ENSP00000377140	0.659	Cyclic nucleotide-gated cation channel alpha-3
12	9606.ENSP00000463201	0.653	SNRPN upstream reading frame
13	9606.ENSP00000349325	0.643	Probable phospholipid-transporting ATPase VA
14	9606.ENSP00000365682	0.627	Transducin-like enhancer protein 1
15	9606.ENSP00000286548	0.607	Guanine nucleotide-binding protein G(q) subunit alpha
16	9606.ENSP00000413418	0.557	Zinc finger homeobox protein 2
17	9606.ENSP00000413405	0.543	GPI mannosyltransferase 4
18	9606.ENSP00000232165	0.541	Ubiquitin-protein ligase E3A
19	9606.ENSP00000337618	0.503	Magnesium transporter NIPA2
20	9606.ENSP00000311030	0.500	Multidrug resistance-associated protein 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0065007	0.801	biological regulation
GO:0050789	0.762	regulation of biological process
GO:0050794	0.733	regulation of cellular process
GO:0032501	0.334	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005654	1.000	nucleoplasm
GO:0005737	0.756	cytoplasm
GO:0032991	0.345	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]