StarFunc result for job id Q9NZQ7

User Input

>input (290 residues)
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZQ7	1.000	1.000	9.799E-54	290	1.000	1.000	Q9NZQ7.pdb.gz	PD1L1_HUMAN Programmed cell death 1 ligand 1 OS=Homo sapiens OX=9606 GN=CD274 PE=1 SV=1
2	AFDB:Q4QTK1	0.822	0.830	6.091E-42	287	0.738	0.746	Q4QTK1.pdb.gz	Q4QTK1_PIG CD274 molecule OS=Sus scrofa OX=9823 GN=CD274 PE=2 SV=1
3	AFDB:D4AE25	0.741	0.741	1.194E-40	290	0.700	0.700	D4AE25.pdb.gz	D4AE25_RAT CD274 molecule OS=Rattus norvegicus OX=10116 GN=Cd274 PE=4 SV=2
4	AFDB:Q9EP73	0.762	0.762	1.893E-39	290	0.697	0.697	Q9EP73.pdb.gz	PD1L1_MOUSE Programmed cell death 1 ligand 1 OS=Mus musculus OX=10090 GN=Cd274 PE=1 SV=1
5	AFDB:Q9BQ51	0.512	0.538	3.235E-21	273	0.341	0.363	Q9BQ51.pdb.gz	PD1L2_HUMAN Programmed cell death 1 ligand 2 OS=Homo sapiens OX=9606 GN=PDCD1LG2 PE=1 SV=2
6	AFDB:Q8VE98	0.531	0.495	1.511E-20	316	0.276	0.253	Q8VE98.pdb.gz	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
7	AFDB:Q5ZPR3	0.526	0.313	3.535E-20	534	0.262	0.142	Q5ZPR3.pdb.gz	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
8	AFDB:Q7TST0	0.527	0.325	2.271E-19	509	0.197	0.112	Q7TST0.pdb.gz	BTNL1_MOUSE Butyrophilin-like protein 1 OS=Mus musculus OX=10090 GN=Btnl1 PE=2 SV=3
9	AFDB:Q62556	0.532	0.319	2.962E-19	524	0.231	0.128	Q62556.pdb.gz	BT1A1_MOUSE Butyrophilin subfamily 1 member A1 OS=Mus musculus OX=10090 GN=Btn1a1 PE=1 SV=2
10	AFDB:Q9WUL5	0.538	0.612	3.294E-19	247	0.290	0.340	Q9WUL5.pdb.gz	PD1L2_MOUSE Programmed cell death 1 ligand 2 OS=Mus musculus OX=10090 GN=Pdcd1lg2 PE=1 SV=1
11	PDB:5c7kF	0.283	0.369	5.838E-11	212	0.114	0.156	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
12	PDB:4xnyL	0.282	0.373	2.090E-10	211	0.124	0.171	4xnyL.pdb.gz
13	PDB:6dcvA	0.328	0.417	2.324E-10	220	0.124	0.164	6dcvA.pdb.gz
14	PDB:1n0xL	0.306	0.396	2.451E-10	215	0.121	0.163	1n0xL.pdb.gz	Crystal Structure of a Broadly Neutralizing Anti-HIV-1 Antibody in Complex with a Peptide Mimotope
15	PDB:1gafL	0.311	0.406	3.750E-10	214	0.121	0.164	1gafL.pdb.gz	The immunological evolution of catalysis.
16	PDB:1jnhA	0.291	0.388	5.736E-10	208	0.121	0.168	1jnhA.pdb.gz	Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
17	PDB:1cf8L	0.299	0.386	6.728E-10	215	0.107	0.144	1cf8L.pdb.gz	Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
18	PDB:3u7wL	0.284	0.378	7.095E-10	210	0.121	0.167	3u7wL.pdb.gz
19	PDB:4d9rL	0.307	0.393	7.095E-10	214	0.124	0.168	4d9rL.pdb.gz
20	PDB:6au5C	0.304	0.397	7.891E-10	213	0.100	0.136	6au5C.pdb.gz	Meditope-Fab interaction: threading the hole.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NZQ7	0.0	608	290	1.000	1.000	PD1L1_HUMAN Programmed cell death 1 ligand 1 OS=Homo sapiens OX=9606 GN=CD274 PE=1 SV=1
2	Q4QTK1	1.12e-149	422	287	0.738	0.746	Q4QTK1_PIG CD274 molecule OS=Sus scrofa OX=9823 GN=CD274 PE=2 SV=1
3	Q9EP73	1.08e-148	420	290	0.697	0.697	PD1L1_MOUSE Programmed cell death 1 ligand 1 OS=Mus musculus OX=10090 GN=Cd274 PE=1 SV=1
4	D4AE25	2.03e-147	416	290	0.700	0.700	D4AE25_RAT CD274 molecule OS=Rattus norvegicus OX=10116 GN=Cd274 PE=4 SV=2
5	Q9BQ51	2.88e-43	150	273	0.328	0.348	PD1L2_HUMAN Programmed cell death 1 ligand 2 OS=Homo sapiens OX=9606 GN=PDCD1LG2 PE=1 SV=2
6	Q9WUL5	1.59e-35	130	247	0.310	0.364	PD1L2_MOUSE Programmed cell death 1 ligand 2 OS=Mus musculus OX=10090 GN=Pdcd1lg2 PE=1 SV=1
7	Q5ZPR3	4.96e-32	126	534	0.290	0.157	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
8	Q8VE98	6.23e-28	111	316	0.248	0.228	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
9	Q62556	3.08e-17	83.6	524	0.228	0.126	BT1A1_MOUSE Butyrophilin subfamily 1 member A1 OS=Mus musculus OX=10090 GN=Btn1a1 PE=1 SV=2
10	Q7TSP5	3.78e-14	73.2	283	0.207	0.212	VTCN1_MOUSE V-set domain containing T-cell activation inhibitor 1 OS=Mus musculus OX=10090 GN=Vtcn1 PE=1 SV=1
11	Q7Z7D3	8.17e-12	66.6	282	0.190	0.195	VTCN1_HUMAN V-set domain-containing T-cell activation inhibitor 1 OS=Homo sapiens OX=9606 GN=VTCN1 PE=1 SV=1
12	Q13410	2.23e-11	66.2	526	0.221	0.122	BT1A1_HUMAN Butyrophilin subfamily 1 member A1 OS=Homo sapiens OX=9606 GN=BTN1A1 PE=1 SV=3
13	Q7TST0	7.91e-11	64.7	509	0.172	0.098	BTNL1_MOUSE Butyrophilin-like protein 1 OS=Mus musculus OX=10090 GN=Btnl1 PE=2 SV=3
14	Q00609	3.02e-10	62.0	306	0.190	0.180	CD80_MOUSE T-lymphocyte activation antigen CD80 OS=Mus musculus OX=10090 GN=Cd80 PE=1 SV=1
15	M0RD77	9.29e-10	60.8	313	0.217	0.201	M0RD77_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=4 SV=1
16	Q6MG92	1.76e-09	60.5	588	0.217	0.107	Q6MG92_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=3 SV=1
17	A0A0G2K9U4	2.03e-09	59.7	346	0.231	0.194	A0A0G2K9U4_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=4 SV=2
18	A2CG22	2.06e-09	60.5	539	0.241	0.130	A2CG22_MOUSE Butyrophilin-like 6 OS=Mus musculus OX=10090 GN=Btnl6 PE=1 SV=1
19	G3V671	1.82e-08	57.0	324	0.159	0.142	G3V671_RAT Cd80 molecule OS=Rattus norvegicus OX=10116 GN=Cd80 PE=4 SV=2
20	Q9JHJ8	2.95e-08	56.2	322	0.176	0.158	ICOSL_MOUSE ICOS ligand OS=Mus musculus OX=10090 GN=Icoslg PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20578 aBig_2	1e+02	14.1	Atrophied bacterial Ig domain
2	PF07654 C1-set	0.22	23.2	Immunoglobulin C1-set domain
3	PF08205 C2-set_2	2.6e-06	38.7	CD80-like C2-set immunoglobulin domain
4	PF07679 I-set	1.8e-06	39.3	Immunoglobulin I-set domain
5	PF00047 ig	3.7e-06	38.4	Immunoglobulin domain
6	PF13895 Ig_2	0.00047	31.7	Immunoglobulin domain
7	PF13927 Ig_3	6.3e-10	50.8	Immunoglobulin domain
8	PF07686 V-set	0.00012	33.6	Immunoglobulin V-set domain
9	PF08204 V-set_CD47	56	15.1	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370989

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335062	0.999	Programmed cell death protein 1
2	9606.ENSP00000011653	0.988	T-cell surface glycoprotein CD4
3	9606.ENSP00000264246	0.988	T-lymphocyte activation antigen CD80
4	9606.ENSP00000303939	0.987	Cytotoxic T-lymphocyte protein 4
5	9606.ENSP00000380855	0.977	Programmed cell death 1 ligand 2
6	9606.ENSP00000340944	0.974	Tyrosine-protein phosphatase non-receptor type 11
7	9606.ENSP00000354782	0.960	T-cell surface glycoprotein CD3 zeta chain
8	9606.ENSP00000376322	0.959	Homeobox protein Hox-D13
9	9606.ENSP00000354566	0.946	T-cell surface glycoprotein CD3 epsilon chain
10	9606.ENSP00000378786	0.935	HLA class II histocompatibility antigen, DR alpha chain
11	9606.ENSP00000339398	0.931	Major histocompatibility complex, class II, DQ alpha 1
12	9606.ENSP00000300692	0.930	T-cell surface glycoprotein CD3 delta chain
13	9606.ENSP00000353099	0.929	HLA class II histocompatibility antigen, DRB1-15 beta chain
14	9606.ENSP00000324890	0.925	T-cell-specific surface glycoprotein CD28
15	9606.ENSP00000364080	0.925	HLA class II histocompatibility antigen, DQ beta 1 chain
16	9606.ENSP00000431445	0.925	T-cell surface glycoprotein CD3 gamma chain
17	9606.ENSP00000364076	0.924	HLA class II histocompatibility antigen, DQ alpha 2 chain
18	9606.ENSP00000390431	0.924	Major histocompatibility complex, class II, DQ beta 2
19	9606.ENSP00000393566	0.924	HLA class II histocompatibility antigen, DP alpha 1 chain
20	9606.ENSP00000408146	0.920	HLA class II histocompatibility antigen, DP beta 1 chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051239	0.995	regulation of multicellular organismal process
GO:0048519	0.995	negative regulation of biological process
GO:0048518	0.995	positive regulation of biological process
GO:0030155	0.995	regulation of cell adhesion
GO:0042130	0.992	negative regulation of T cell proliferation
GO:0046006	0.989	regulation of activated T cell proliferation
GO:0048522	0.984	positive regulation of cellular process
GO:0009987	0.957	cellular process
GO:0051240	0.948	positive regulation of multicellular organismal process
GO:2000106	0.947	regulation of leukocyte apoptotic process
GO:0050870	0.937	positive regulation of T cell activation
GO:0070228	0.920	regulation of lymphocyte apoptotic process
GO:0050896	0.912	response to stimulus
GO:0001817	0.880	regulation of cytokine production
GO:0008284	0.863	positive regulation of cell population proliferation
GO:0070665	0.846	positive regulation of leukocyte proliferation
GO:0001819	0.840	positive regulation of cytokine production
GO:0032946	0.821	positive regulation of mononuclear cell proliferation
GO:0050671	0.810	positive regulation of lymphocyte proliferation
GO:0051716	0.789	cellular response to stimulus
GO:0042102	0.753	positive regulation of T cell proliferation
GO:0048583	0.707	regulation of response to stimulus
GO:0010629	0.678	negative regulation of gene expression
GO:0032649	0.653	regulation of type II interferon production
GO:0023052	0.630	signaling
GO:0007165	0.615	signal transduction
GO:0001818	0.562	negative regulation of cytokine production
GO:0043065	0.526	positive regulation of apoptotic process
GO:0070232	0.514	regulation of T cell apoptotic process
GO:0032689	0.486	negative regulation of type II interferon production
GO:0002376	0.473	immune system process
GO:0048584	0.460	positive regulation of response to stimulus
GO:0042221	0.420	response to chemical
GO:0050776	0.335	regulation of immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.993	intracellular anatomical structure
GO:0043226	0.985	organelle
GO:0043227	0.973	membrane-bounded organelle
GO:0043229	0.939	intracellular organelle
GO:0031982	0.916	vesicle
GO:0005576	0.902	extracellular region
GO:0005737	0.833	cytoplasm
GO:0005615	0.779	extracellular space
GO:0043231	0.778	intracellular membrane-bounded organelle
GO:0012505	0.660	endomembrane system
GO:0070013	0.594	intracellular organelle lumen
GO:1903561	0.556	extracellular vesicle
GO:0009986	0.533	cell surface
GO:0070062	0.502	extracellular exosome
GO:0005654	0.486	nucleoplasm
GO:0031410	0.349	cytoplasmic vesicle
GO:0031090	0.329	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]