StarFunc result for job id Q9NZQ8

User Input

>input (1165 residues)
MQDVQGPRPGSPGDAEDRRELGLHRGEVNFGGSGKKRGKFVRVPSGVAPSVLFDLLLAEW
HLPAPNLVVSLVGEEQPFAMKSWLRDVLRKGLVKAAQSTGAWILTSALRVGLARHVGQAV
RDHSLASTSTKVRVVAVGMASLGRVLHRRILEEAQEDFPVHYPEDDGGSQGPLCSLDSNL
SHFILVEPGPPGKGDGLTELRLRLEKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERI
SRAVEQAAPWLILVGSGGIADVLAALVNQPHLLVPKVAEKQFKEKFPSKHFSWEDIVRWT
KLLQNITSHQHLLTVYDFEQEGSEELDTVILKALVKACKSHSQEPQDYLDELKLAVAWDR
VDIAKSEIFNGDVEWKSCDLEEVMVDALVSNKPEFVRLFVDNGADVADFLTYGRLQELYR
SVSRKSLLFDLLQRKQEEARLTLAGLGTQQAREPPAGPPAFSLHEVSRVLKDFLQDACRG
FYQDGRPGDRRRAEKGPAKRPTGQKWLLDLNQKSENPWRDLFLWAVLQNRHEMATYFWAM
GQEGVAAALAACKILKEMSHLETEAEAARATREAKYERLALDLFSECYSNSEARAFALLV
RRNRCWSKTTCLHLATEADAKAFFAHDGVQAFLTRIWWGDMAAGTPILRLLGAFLCPALV
YTNLITFSEEAPLRTGLEDLQDLDSLDTEKSPLYGLQSRVEELVEAPRAQGDRGPRAVFL
LTRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLLVDFRPPPQGPSGPEVTLYFWVFTLVL
EEIRQGFFTDEDTHLVKKFTLYVGDNWNKCDMVAIFLFIVGVTCRMLPSAFEAGRTVLAM
DFMVFTLRLIHIFAIHKQLGPKIIVVERMMKDVFFFLFFLSVWLVAYGVTTQALLHPHDG
RLEWIFRRVLYRPYLQIFGQIPLDEIDEARVNCSTHPLLLEDSPSCPSLYANWLVILLLV
TFLLVTNVLLMNLLIAMFSYTFQVVQGNADMFWKFQRYNLIVEYHERPALAPPFILLSHL
SLTLRRVFKKEAEHKREHLERDLPDPLDQKVVTWETVQKENFLSKMEKRRRDSEGEVLRK
TAHRVDFIAKYLGGLREQEKRIKCLESQINYCSVLVSSVADVLAQGGGPRSSQHCGEGSQ
LVAADHRGGLDGWEQPGAGQPPSDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LMD7	0.793	0.799	0.000	1156	0.828	0.835	F1LMD7.pdb.gz	F1LMD7_RAT Transient receptor potential cation channel, subfamily M, member 5 OS=Rattus norvegicus OX=10116 GN=Trpm5 PE=4 SV=3
2	AFDB:Q9NZQ8	1.000	1.000	0.000	1165	1.000	1.000	Q9NZQ8.pdb.gz	TRPM5_HUMAN Transient receptor potential cation channel subfamily M member 5 OS=Homo sapiens OX=9606 GN=TRPM5 PE=1 SV=1
3	AFDB:Q8TD43	0.815	0.784	5.114E-89	1214	0.453	0.435	Q8TD43.pdb.gz	TRPM4_HUMAN Transient receptor potential cation channel subfamily M member 4 OS=Homo sapiens OX=9606 GN=TRPM4 PE=1 SV=1
4	AFDB:I3IS25	0.774	0.720	5.886E-88	1260	0.442	0.409	I3IS25.pdb.gz
5	AFDB:Q7TN37	0.769	0.741	6.628E-84	1213	0.434	0.417	Q7TN37.pdb.gz	TRPM4_MOUSE Transient receptor potential cation channel subfamily M member 4 OS=Mus musculus OX=10090 GN=Trpm4 PE=1 SV=1
6	AFDB:E9PTA2	0.800	0.626	1.464E-78	1507	0.379	0.293	E9PTA2.pdb.gz	TRPM2_RAT Transient receptor potential cation channel subfamily M member 2 OS=Rattus norvegicus OX=10116 GN=Trpm2 PE=1 SV=3
7	AFDB:O94759	0.756	0.597	3.890E-78	1503	0.381	0.295	O94759.pdb.gz	TRPM2_HUMAN Transient receptor potential cation channel subfamily M member 2 OS=Homo sapiens OX=9606 GN=TRPM2 PE=1 SV=2
8	AFDB:A0A0R4IMY7	0.789	0.636	1.954E-75	1470	0.371	0.294	A0A0R4IMY7.pdb.gz	TRPM2_DANRE Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2
9	PDB:6bcqB	0.670	0.780	9.918E-70	983	0.411	0.487	6bcqB.pdb.gz	Structures of the calcium-activated, non-selective cation channel TRPM4.
10	PDB:6puuA	0.731	0.655	3.171E-68	1309	0.361	0.321	6puuA.pdb.gz	Ligand recognition and gating mechanism through three ligand-binding sites of human TRPM2 channel.
11	AFDB:A7T1N0	0.742	0.568	4.414E-67	1551	0.294	0.221	A7T1N0.pdb.gz	TMP2L_NEMVE Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1
12	PDB:6bqrA	0.659	0.796	1.014E-66	948	0.412	0.506	6bqrA.pdb.gz	Structure of the human TRPM4 ion channel in a lipid nanodisc.
13	AFDB:Q9HCF6	0.744	0.515	5.119E-65	1732	0.294	0.198	Q9HCF6.pdb.gz	TRPM3_HUMAN Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=1 SV=4
14	PDB:5wp6A	0.639	0.746	1.142E-62	977	0.413	0.492	5wp6A.pdb.gz	Electron cryo-microscopy structure of a human TRPM4 channel.
15	PDB:6co7A	0.721	0.786	2.159E-60	1061	0.288	0.317	6co7A.pdb.gz	Structure of a TRPM2 channel in complex with Ca2+explains unique gating regulation.
16	PDB:6drjA	0.656	0.610	8.620E-59	1266	0.344	0.317	6drjA.pdb.gz	Architecture of the TRPM2 channel and its activation mechanism by ADP-ribose and calcium.
17	PDB:6pkxB	0.659	0.633	3.149E-57	1218	0.335	0.320	6pkxB.pdb.gz	Visualizing structural transitions of ligand-dependent gating of the TRPM2 channel.
18	PDB:6mj2A	0.727	0.640	1.101E-55	1337	0.370	0.322	6mj2A.pdb.gz	Structures and gating mechanism of human TRPM2.
19	PDB:6pkvA	0.636	0.678	9.081E-52	1087	0.321	0.344	6pkvA.pdb.gz
20	PDB:8e4nA	0.595	0.746	9.149E-51	901	0.293	0.378	8e4nA.pdb.gz	Activation mechanism of the mouse cold-sensing TRPM8 channel by cooling agonist and PIP 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IMY7	0.0	667	1470	0.370	0.293	TRPM2_DANRE Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2
2	A0A455XI77	0.0	1924	1156	0.831	0.837	A0A455XI77_RAT Transient receptor potential cation channel subfamily M member 5 OS=Rattus norvegicus OX=10116 GN=Trpm5 PE=2 SV=1
3	A0A8I6AG64	0.0	1924	1164	0.831	0.832	A0A8I6AG64_RAT Transient receptor potential cation channel, subfamily M, member 5 OS=Rattus norvegicus OX=10116 GN=Trpm5 PE=4 SV=1
4	E9PTA2	0.0	712	1507	0.379	0.293	TRPM2_RAT Transient receptor potential cation channel subfamily M member 2 OS=Rattus norvegicus OX=10116 GN=Trpm2 PE=1 SV=3
5	F1LMD7	0.0	1922	1187	0.831	0.816	F1LMD7_RAT Transient receptor potential cation channel, subfamily M, member 5 OS=Rattus norvegicus OX=10116 GN=Trpm5 PE=4 SV=3
6	O94759	0.0	720	1503	0.387	0.300	TRPM2_HUMAN Transient receptor potential cation channel subfamily M member 2 OS=Homo sapiens OX=9606 GN=TRPM2 PE=1 SV=2
7	Q7TN37	0.0	843	1213	0.440	0.423	TRPM4_MOUSE Transient receptor potential cation channel subfamily M member 4 OS=Mus musculus OX=10090 GN=Trpm4 PE=1 SV=1
8	Q7Z2W7	0.0	567	1104	0.323	0.341	TRPM8_HUMAN Transient receptor potential cation channel subfamily M member 8 OS=Homo sapiens OX=9606 GN=TRPM8 PE=1 SV=2
9	Q8R455	0.0	570	1104	0.323	0.341	TRPM8_RAT Transient receptor potential cation channel subfamily M member 8 OS=Rattus norvegicus OX=10116 GN=Trpm8 PE=1 SV=4
10	Q8R4D5	0.0	573	1104	0.322	0.340	TRPM8_MOUSE Transient receptor potential cation channel subfamily M member 8 OS=Mus musculus OX=10090 GN=Trpm8 PE=1 SV=3
11	Q8TD43	0.0	829	1214	0.447	0.429	TRPM4_HUMAN Transient receptor potential cation channel subfamily M member 4 OS=Homo sapiens OX=9606 GN=TRPM4 PE=1 SV=1
12	Q91YD4	0.0	705	1506	0.380	0.294	TRPM2_MOUSE Transient receptor potential cation channel subfamily M member 2 OS=Mus musculus OX=10090 GN=Trpm2 PE=1 SV=2
13	Q9ESQ5	0.0	833	1208	0.444	0.428	TRPM4_RAT Transient receptor potential cation channel subfamily M member 4 OS=Rattus norvegicus OX=10116 GN=Trpm4 PE=1 SV=2
14	Q9JJH7	0.0	1949	1158	0.843	0.848	TRPM5_MOUSE Transient receptor potential cation channel subfamily M member 5 OS=Mus musculus OX=10090 GN=Trpm5 PE=1 SV=1
15	Q9NZQ8	0.0	2389	1165	1.000	1.000	TRPM5_HUMAN Transient receptor potential cation channel subfamily M member 5 OS=Homo sapiens OX=9606 GN=TRPM5 PE=1 SV=1
16	S5TRY1	0.0	948	1260	0.452	0.417	S5TRY1_DANRE Transient receptor potential cation channel, subfamily M, member 4a OS=Danio rerio OX=7955 GN=TRPM4a PE=2 SV=1
17	U3JD03	0.0	582	1115	0.312	0.326	U3JD03_FICAL Transient receptor potential cation channel subfamily M member 8 OS=Ficedula albicollis OX=59894 PE=1 SV=2
18	A7T1N0	2.86e-155	505	1551	0.308	0.231	TMP2L_NEMVE Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1
19	Q9HCF6	2.34e-143	476	1732	0.298	0.200	TRPM3_HUMAN Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=1 SV=4
20	Q923J1	1.23e-129	438	1863	0.291	0.182	TRPM7_MOUSE Transient receptor potential cation channel subfamily M member 7 OS=Mus musculus OX=10090 GN=Trpm7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00520 Ion_trans	2.6e-08	45.0	Ion transport protein
2	PF18139 LSDAT_euk	7.6e-44	161.7	SLOG in TRPM
3	PF18171 LSDAT_prok	4e-10	50.7	SLOG in TRPM, prokaryote

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000155858

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344411	0.894	Taste receptor type 1 member 3
2	9606.ENSP00000260402	0.879	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
3	9606.ENSP00000381339	0.874	Guanine nucleotide-binding protein G(t) subunit alpha-3
4	9606.ENSP00000364520	0.838	Taste receptor type 1 member 2
5	9606.ENSP00000480090	0.825	Polycystic kidney disease protein 1-like 3
6	9606.ENSP00000459962	0.824	Transient receptor potential cation channel, subfamily V, member 1
7	9606.ENSP00000461007	0.824	Transient receptor potential cation channel subfamily V member 1
8	9606.ENSP00000331867	0.804	Taste receptor type 1 member 1
9	9606.ENSP00000342222	0.800	Transient receptor potential cation channel subfamily V member 2
10	9606.ENSP00000325296	0.789	Polycystic kidney disease 2-like 1 protein
11	9606.ENSP00000368966	0.787	Short transient receptor potential channel 3
12	9606.ENSP00000265310	0.772	Transient receptor potential cation channel subfamily V member 5
13	9606.ENSP00000329926	0.770	Calcium homeostasis modulator protein 1
14	9606.ENSP00000352358	0.751	Transient receptor potential cation channel subfamily V member 6
15	9606.ENSP00000419313	0.751	Short transient receptor potential channel 1
16	9606.ENSP00000262209	0.732	Transient receptor potential cation channel subfamily A member 1
17	9606.ENSP00000331087	0.713	Protein TSSC4
18	9606.ENSP00000363435	0.704	Inositol 1,4,5-trisphosphate receptor type 3
19	9606.ENSP00000227638	0.689	Pannexin-1
20	9606.ENSP00000448219	0.687	Taste receptor type 2 member 38

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0005272	0.997	sodium channel activity
GO:0022839	0.990	monoatomic ion gated channel activity
GO:0005262	0.956	calcium channel activity
GO:0005227	0.577	calcium activated cation channel activity
GO:0042802	0.346	identical protein binding
GO:0043167	0.333	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0006811	0.995	monoatomic ion transport
GO:0055085	0.990	transmembrane transport
GO:0034220	0.948	monoatomic ion transmembrane transport
GO:0006812	0.935	monoatomic cation transport
GO:0006816	0.933	calcium ion transport
GO:0098662	0.925	inorganic cation transmembrane transport
GO:0098655	0.914	monoatomic cation transmembrane transport
GO:0070588	0.873	calcium ion transmembrane transport
GO:0050896	0.614	response to stimulus
GO:0065007	0.565	biological regulation
GO:0050789	0.521	regulation of biological process
GO:0032501	0.517	multicellular organismal process
GO:0050794	0.488	regulation of cellular process
GO:0042221	0.319	response to chemical
GO:0003008	0.313	system process
GO:0051716	0.311	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0120025	0.597	plasma membrane bounded cell projection
GO:0043005	0.436	neuron projection
GO:0036477	0.311	somatodendritic compartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	0.998	Na(+)(in) = Na(+)(out)
RHEA:29671	0.956	Ca(2+)(in) = Ca(2+)(out)

[back to server]