StarFunc result for job id Q9NZR2

User Input

>input (1400 residues)
MSEFLLALLTLSGLLPIARVLTVGADRDQQLCDPGEFLCHDHVTCVSQSWLCDGDPDCPD
DSDESLDTCPEEVEIKCPLNHIACLGTNKCVHLSQLCNGVLDCPDGYDEGVHCQELLSNC
QQLNCQYKCTMVRNSTRCYCEDGFEITEDGRSCKDQDECAVYGTCSQTCRNTHGSYTCSC
VEGYLMQPDNRSCKAKIEPTDRPPILLIANFETIEVFYLNGSKMATLSSVNGNEIHTLDF
IYNEDMICWIESRESSNQLKCIQITKAGGLTDEWTINILQSFHNVQQMAIDWLTRNLYFV
DHVGDRIFVCNSNGSVCVTLIDLELHNPKAIAVDPIAGKLFFTDYGNVAKVERCDMDGMN
RTRIIDSKTEQPAALALDLVNKLVYWVDLYLDYVGVVDYQGKNRHTVIQGRQVRHLYGIT
VFEDYLYATNSDNYNIVRINRFNGTDIHSLIKIENAWGIRIYQKRTQPTVRSHACEVDPY
GMPGGCSHICLLSSSYKTRTCRCRTGFNLGSDGRSCKRPKNELFLFYGKGRPGIVRGMDL
NTKIADEYMIPIENLVNPRALDFHAETNYIYFADTTSFLIGRQKIDGTERETILKDDLDN
VEGIAVDWIGNNLYWTNDGHRKTINVARLEKASQSRKTLLEGEMSHPRGIVVDPVNGWMY
WTDWEEDEIDDSVGRIEKAWMDGFNRQIFVTSKMLWPNGLTLDFHTNTLYWCDAYYDHIE
KVFLNGTHRKIVYSGRELNHPFGLSHHGNYVFWTDYMNGSIFQLDLITSEVTLLRHERPP
LFGLQIYDPRKQQGDNMCRVNNGGCSTLCLAIPGGRVCACADNQLLDENGTTCTFNPGEA
LPHICKAGEFRCKNRHCIQARWKCDGDDDCLDGSDEDSVNCFNHSCPDDQFKCQNNRCIP
KRWLCDGANDCGSNEDESNQTCTARTCQVDQFSCGNGRCIPRAWLCDREDDCGDQTDEMA
SCEFPTCEPLTQFVCKSGRCISSKWHCDSDDDCGDGSDEVGCVHSCFDNQFRCSSGRCIP
GHWACDGDNDCGDFSDEAQINCTKEEIHSPAGCNGNEFQCHPDGNCVPDLWRCDGEKDCE
DGSDEKGCNGTIRLCDHKTKFSCWSTGRCINKAWVCDGDIDCEDQSDEDDCDSFLCGPPK
HPCANDTSVCLQPEKLCNGKKDCPDGSDEGYLCDECSLNNGGCSNHCSVVPGRGIVCSCP
EGLQLNKDNKTCEIVDYCSNHLKCSQVCEQHKHTVKCSCYEGWKLDVDGESCTSVDPFEA
FIIFSIRHEIRRIDLHKRDYSLLVPGLRNTIALDFHFNQSLLYWTDVVEDRIYRGKLSES
GGVSAIEVVVEHGLATPEGLTVDWIAGNIYWIDSNLDQIEVAKLDGSLRTTLIAGAMEHP
RAIALDPRYGILFWTDWDAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P98163	0.296	0.217	2.024E-100	1984	0.281	0.199	P98163.pdb.gz	YL_DROME Putative vitellogenin receptor OS=Drosophila melanogaster OX=7227 GN=yl PE=1 SV=2
2	AFDB:Q6X0I2	0.284	0.230	1.180E-97	1782	0.278	0.218	Q6X0I2.pdb.gz	VGR_SOLIN Vitellogenin receptor OS=Solenopsis invicta OX=13686 GN=VgR PE=2 SV=1
3	AFDB:O75096	0.421	0.316	8.599E-90	1905	0.269	0.198	O75096.pdb.gz	LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens OX=9606 GN=LRP4 PE=1 SV=4
4	AFDB:Q9VXM0	0.410	0.296	1.554E-88	2009	0.241	0.168	Q9VXM0.pdb.gz	Q9VXM0_DROME LDL receptor related protein 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Lrp4 PE=4 SV=1
5	AFDB:F1M443	0.205	0.339	1.436E-82	752	0.338	0.629	F1M443.pdb.gz	F1M443_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=4
6	AFDB:A0A140LH43	0.268	0.312	1.075E-80	1190	0.270	0.318	A0A140LH43.pdb.gz
7	AFDB:F1QTJ4	0.382	0.336	2.494E-72	1615	0.198	0.172	F1QTJ4.pdb.gz	F1QTJ4_DANRE Low density lipoprotein receptor-related protein 5 OS=Danio rerio OX=7955 GN=LRP6 PE=1 SV=1
8	AFDB:A0A0G2K0H3	0.379	0.334	3.244E-72	1613	0.209	0.182	A0A0G2K0H3.pdb.gz	A0A0G2K0H3_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp6 PE=3 SV=1
9	AFDB:A1Z9D7	0.368	0.312	3.420E-72	1678	0.197	0.164	A1Z9D7.pdb.gz	A1Z9D7_DROME Low-density lipoprotein receptor-related protein OS=Drosophila melanogaster OX=7227 GN=arr PE=2 SV=1
10	AFDB:O75197	0.383	0.336	2.663E-71	1615	0.206	0.178	O75197.pdb.gz	LRP5_HUMAN Low-density lipoprotein receptor-related protein 5 OS=Homo sapiens OX=9606 GN=LRP5 PE=1 SV=2
11	PDB:7mq8LR	0.160	0.269	3.595E-17	773	0.044	0.080	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7mq8LT	0.168	0.250	1.590E-15	869	0.055	0.089	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7mqaLQ	0.180	0.278	2.837E-15	830	0.043	0.072	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:5wyjBA	0.159	0.273	6.585E-15	755	0.041	0.077	5wyjBA.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
15	PDB:7mq8LO	0.157	0.244	9.030E-15	848	0.042	0.070	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7ajuUL	0.182	0.297	1.989E-14	779	0.051	0.091	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:7mq8LN	0.142	0.268	4.616E-14	671	0.046	0.095	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:1nr0A	0.166	0.330	4.865E-14	610	0.041	0.093	1nr0A.pdb.gz
19	PDB:7d5sB2	0.161	0.244	6.330E-14	851	0.048	0.079	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
20	PDB:1n6dA	0.156	0.204	8.235E-14	1023	0.056	0.076	1n6dA.pdb.gz	Navigation Inside a Protease: Substrate Selection and Product Exit in the Tricorn Protease from Thermoplasma acidophilum

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KFD1	650	4752	0.326	0.096	A0A0B4KFD1_DROME LDL receptor protein 1, isoform F OS=Drosophila melanogaster OX=7227 GN=LRP1 PE=1 SV=1
2	A0A8I6AQY2	2373	4469	0.815	0.255	A0A8I6AQY2_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=1
3	A1Z7C4	650	4730	0.326	0.097	A1Z7C4_DROME LDL receptor protein 1, isoform G OS=Drosophila melanogaster OX=7227 GN=LRP1 PE=1 SV=2
4	A2ARV4	808	4660	0.363	0.109	LRP2_MOUSE Low-density lipoprotein receptor-related protein 2 OS=Mus musculus OX=10090 GN=Lrp2 PE=1 SV=1
5	A8JTM7	719	4769	0.350	0.103	A8JTM7_DROME Megalin, isoform A OS=Drosophila melanogaster OX=7227 GN=mgl PE=1 SV=2
6	C0HL13	793	4652	0.359	0.108	LRP2_PIG Low-density lipoprotein receptor-related protein 2 OS=Sus scrofa OX=9823 GN=LRP2 PE=1 SV=1
7	E0AE56	604	4673	0.311	0.093	E0AE56_DANRE Low-density lipoprotein receptor-related protein 2 OS=Danio rerio OX=7955 GN=lrp2 PE=1 SV=1
8	E1BGJ0	1909	4545	0.636	0.196	E1BGJ0_BOVIN LDL receptor related protein 1 OS=Bos taurus OX=9913 GN=LRP1 PE=1 SV=3
9	F1M443	2374	4436	0.815	0.257	F1M443_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=4
10	F1QY34	1844	4549	0.613	0.189	F1QY34_DANRE Low density lipoprotein receptor-related protein 1Ab OS=Danio rerio OX=7955 GN=lrp1ab PE=1 SV=1
11	G3V928	1916	4545	0.639	0.197	LRP1_RAT Prolow-density lipoprotein receptor-related protein 1 OS=Rattus norvegicus OX=10116 GN=Lrp1 PE=1 SV=1
12	P98158	808	4660	0.363	0.109	LRP2_RAT Low-density lipoprotein receptor-related protein 2 OS=Rattus norvegicus OX=10116 GN=Lrp2 PE=1 SV=1
13	P98164	784	4655	0.345	0.104	LRP2_HUMAN Low-density lipoprotein receptor-related protein 2 OS=Homo sapiens OX=9606 GN=LRP2 PE=1 SV=3
14	Q04833	625	4753	0.341	0.100	LRP_CAEEL Low-density lipoprotein receptor-related protein OS=Caenorhabditis elegans OX=6239 GN=lrp-1 PE=1 SV=1
15	Q07954	1904	4544	0.636	0.196	LRP1_HUMAN Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens OX=9606 GN=LRP1 PE=1 SV=2
16	Q7Z5C0	784	4655	0.345	0.104	Q7Z5C0_HUMAN Glycoprotein receptor gp330/megalin OS=Homo sapiens OX=9606 PE=2 SV=1
17	Q7Z5C1	782	4655	0.344	0.104	Q7Z5C1_HUMAN Glycoprotein receptor gp330/megalin OS=Homo sapiens OX=9606 PE=2 SV=1
18	Q91ZX7	1914	4545	0.639	0.197	LRP1_MOUSE Prolow-density lipoprotein receptor-related protein 1 OS=Mus musculus OX=10090 GN=Lrp1 PE=1 SV=1
19	Q9JI18	2603	4599	0.896	0.273	LRP1B_MOUSE Low-density lipoprotein receptor-related protein 1B OS=Mus musculus OX=10090 GN=Lrp1b PE=1 SV=1
20	Q9NZR2	2898	4599	1.000	0.304	LRP1B_HUMAN Low-density lipoprotein receptor-related protein 1B OS=Homo sapiens OX=9606 GN=LRP1B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	7.2e-11	53.1	Complement Clr-like EGF-like
2	PF16472 DUF5050	3.9e-07	41.1	Domain of unknown function (DUF5050)
3	PF07645 EGF_CA	0.012	27.1	Calcium-binding EGF domain
4	PF14670 FXa_inhibition	2.3e-25	99.9	Coagulation Factor Xa inhibitory site
5	PF00057 Ldl_recept_a	1.3e-93	318.2	Low-density lipoprotein receptor domain class A
6	PF00058 Ldl_recept_b	3e-65	227.8	Low-density lipoprotein receptor repeat class B
7	PF05866 RusA	3.7e+02	13.1	Endodeoxyribonuclease RusA
8	PF08450 SGL	1e-05	36.8	SMP-30/Gluconolactonase/LRE-like region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374135

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252486	0.770	Apolipoprotein E
2	9606.ENSP00000223095	0.765	Plasminogen activator inhibitor 1
3	9606.ENSP00000297405	0.666	CUB and sushi domain-containing protein 3
4	9606.ENSP00000284981	0.663	Amyloid-beta A4 protein
5	9606.ENSP00000239367	0.609	Low-density lipoprotein receptor-related protein 11
6	9606.ENSP00000370593	0.594	Receptor-type tyrosine-protein phosphatase delta
7	9606.ENSP00000384193	0.565	Cell adhesion molecule 2
8	9606.ENSP00000321951	0.562	Protein lifeguard 2
9	9606.ENSP00000417480	0.544	Bis(5'-adenosyl)-triphosphatase
10	9606.ENSP00000322251	0.543	Serine/threonine-protein kinase TNNI3K
11	9606.ENSP00000369328	0.540	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2
12	9606.ENSP00000375909	0.532	A-kinase anchor protein SPHKAP
13	9606.ENSP00000363458	0.530	Low density lipoprotein receptor adapter protein 1
14	9606.ENSP00000253047	0.519	Transmembrane protein 160
15	9606.ENSP00000277120	0.511	BDNF/NT-3 growth factors receptor
16	9606.ENSP00000356224	0.506	Nesprin-1
17	9606.ENSP00000012049	0.505	Glutaminyl-peptide cyclotransferase-like protein
18	9606.ENSP00000272641	0.505	Neurexophilin-2
19	9606.ENSP00000421922	0.505	Alpha-2-macroglobulin receptor-associated protein
20	9606.ENSP00000476119	0.503	Diphosphoinositol polyphosphate phosphohydrolase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038024	0.475	cargo receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051179	0.619	localization
GO:0009987	0.586	cellular process
GO:0032501	0.310	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0016020	0.990	membrane
GO:0032991	0.740	protein-containing complex
GO:0043235	0.572	receptor complex
GO:0005886	0.538	plasma membrane
GO:0043226	0.531	organelle
GO:0005622	0.524	intracellular anatomical structure
GO:0043227	0.433	membrane-bounded organelle
GO:0043229	0.431	intracellular organelle
GO:0043231	0.424	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]