StarFunc result for job id Q9NZS9

User Input

>input (450 residues)
MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLAL
WWASSKKTECPECREKWEGFPKVSILLRDAIEKLFPDAIRLRFEDIQQNNDIVQSLAAFQ
KYGNDQIPLAPNTGRANQQMGGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVA
KWTAEEVVLWLEQLGPWASLYRERFLSERVNGRLLLTLTEEEFSKTPYTIENSSHRRAIL
MELERVKALGVKPPQNLWEYKAVNPGRSLFLLYALKSSPRLSLLYLYLFDYTDTFLPFIH
TICPLQEDSSGEDIVTKLLDLKEPTWKQWREFLVKYSFLPYQLIAEFAWDWLEVHYWTSR
FLIINAMLLSVLELFSFWRIWSRSELKTVPQRMWSHFWKVSTQGLFVAMFWPLIPQFVCN
CLFYWALYFNPIINIDLVVKELRRLETQVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZS9	1.000	1.000	2.099E-66	450	1.000	1.000	Q9NZS9.pdb.gz	BFAR_HUMAN Bifunctional apoptosis regulator OS=Homo sapiens OX=9606 GN=BFAR PE=1 SV=1
2	AFDB:Q96EP1	0.181	0.128	1.879E-4	664	0.062	0.042	Q96EP1.pdb.gz	CHFR_HUMAN E3 ubiquitin-protein ligase CHFR OS=Homo sapiens OX=9606 GN=CHFR PE=1 SV=2
3	AFDB:Q810L3	0.181	0.128	2.504E-4	664	0.062	0.042	Q810L3.pdb.gz	CHFR_MOUSE E3 ubiquitin-protein ligase CHFR OS=Mus musculus OX=10090 GN=Chfr PE=1 SV=1
4	AFDB:Q8LBL5	0.205	0.225	2.891E-4	410	0.082	0.090	Q8LBL5.pdb.gz	PRT1_ARATH E3 ubiquitin-protein ligase PRT1 OS=Arabidopsis thaliana OX=3702 GN=PRT1 PE=2 SV=2
5	AFDB:Q5FWP4	0.180	0.135	3.181E-4	625	0.058	0.042	Q5FWP4.pdb.gz	CHFR_XENLA E3 ubiquitin-protein ligase CHFR OS=Xenopus laevis OX=8355 GN=chfr PE=1 SV=1
6	AFDB:Q86WT6	0.153	0.139	6.217E-4	500	0.120	0.108	Q86WT6.pdb.gz	TRI69_HUMAN E3 ubiquitin-protein ligase TRIM69 OS=Homo sapiens OX=9606 GN=TRIM69 PE=1 SV=2
7	AFDB:F4ICB5	0.164	0.151	7.897E-4	491	0.064	0.059	F4ICB5.pdb.gz	F4ICB5_ARATH Zinc finger (C3HC4-type RING finger) family protein OS=Arabidopsis thaliana OX=3702 GN=IAP1 PE=1 SV=1
8	AFDB:Q9UPQ4	0.156	0.143	1.003E-3	493	0.136	0.124	Q9UPQ4.pdb.gz	TRI35_HUMAN E3 ubiquitin-protein ligase TRIM35 OS=Homo sapiens OX=9606 GN=TRIM35 PE=1 SV=2
9	AFDB:Q8C006	0.157	0.142	1.104E-3	501	0.140	0.126	Q8C006.pdb.gz	TRI35_MOUSE E3 ubiquitin-protein ligase TRIM35 OS=Mus musculus OX=10090 GN=Trim35 PE=1 SV=2
10	AFDB:Q5VRH9	0.133	0.100	1.158E-3	611	0.120	0.088	Q5VRH9.pdb.gz	PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza sativa subsp. japonica OX=39947 GN=PUB12 PE=2 SV=1
11	PDB:5dkaA	0.132	0.582	1.202E-2	96	0.040	0.188	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
12	PDB:4r8pL	0.151	0.261	2.584E-2	254	0.062	0.110	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:3bs5A	0.156	0.761	2.844E-2	86	0.040	0.209	3bs5A.pdb.gz
14	PDB:5gm6a	0.131	0.422	5.830E-2	123	0.051	0.187	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:7anwA	0.149	0.105	6.730E-2	645	0.091	0.064	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
16	PDB:7cm7A	0.149	0.109	1.086E-1	620	0.084	0.061	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
17	PDB:5a31B	0.119	0.512	2.570E-1	84	0.036	0.190	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
18	PDB:7jzvA	0.132	0.228	3.953E-1	253	0.049	0.087	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
19	PDB:6brhB	0.145	0.131	4.350E-1	502	0.047	0.042	6brhB.pdb.gz	The SAM domain of mouse SAMHD1 is critical for its activation and regulation.
20	PDB:5l9uB	0.088	0.473	4.563E-1	71	0.036	0.225	5l9uB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NZS9	0.0	926	450	1.000	1.000	BFAR_HUMAN Bifunctional apoptosis regulator OS=Homo sapiens OX=9606 GN=BFAR PE=1 SV=1
2	Q8LBL5	4.53e-10	63.5	410	0.093	0.102	PRT1_ARATH E3 ubiquitin-protein ligase PRT1 OS=Arabidopsis thaliana OX=3702 GN=PRT1 PE=2 SV=2
3	F1QYX5	3.14e-08	58.2	582	0.053	0.041	F1QYX5_DANRE Bloodthirsty-related gene family, member 1 OS=Danio rerio OX=7955 GN=btr01 PE=4 SV=2
4	A0A0R4IUT0	6.30e-08	57.4	544	0.056	0.046	A0A0R4IUT0_DANRE Bloodthirsty-related gene family, member 20 OS=Danio rerio OX=7955 GN=btr20 PE=4 SV=1
5	F4ICB5	8.64e-08	56.6	491	0.087	0.079	F4ICB5_ARATH Zinc finger (C3HC4-type RING finger) family protein OS=Arabidopsis thaliana OX=3702 GN=IAP1 PE=1 SV=1
6	Q96BQ3	1.95e-07	55.5	446	0.060	0.061	TRI43_HUMAN Tripartite motif-containing protein 43 OS=Homo sapiens OX=9606 GN=TRIM43 PE=1 SV=1
7	Q8IUD6	2.45e-07	55.1	432	0.069	0.072	RN135_HUMAN E3 ubiquitin-protein ligase RNF135 OS=Homo sapiens OX=9606 GN=RNF135 PE=1 SV=2
8	Q8R0K2	2.49e-06	52.0	507	0.060	0.053	TRI31_MOUSE E3 ubiquitin-protein ligase TRIM31 OS=Mus musculus OX=10090 GN=Trim31 PE=1 SV=1
9	Q3UWZ0	2.55e-06	52.0	467	0.047	0.045	TRI75_MOUSE Tripartite motif-containing protein 75 OS=Mus musculus OX=10090 GN=Trim75 PE=1 SV=1
10	Q8C006	2.97e-06	52.0	501	0.053	0.048	TRI35_MOUSE E3 ubiquitin-protein ligase TRIM35 OS=Mus musculus OX=10090 GN=Trim35 PE=1 SV=2
11	Q495X7	3.55e-06	51.6	471	0.049	0.047	TRI60_HUMAN Tripartite motif-containing protein 60 OS=Homo sapiens OX=9606 GN=TRIM60 PE=1 SV=2
12	Q6PJ69	5.15e-06	51.2	517	0.056	0.048	TRI65_HUMAN E3 ubiquitin-protein ligase TRIM65 OS=Homo sapiens OX=9606 GN=TRIM65 PE=1 SV=3
13	Q9CWS1	5.96e-06	50.8	417	0.064	0.070	RN135_MOUSE E3 ubiquitin-protein ligase RNF135 OS=Mus musculus OX=10090 GN=Rnf135 PE=2 SV=1
14	Q9D9R0	8.63e-06	49.3	233	0.053	0.103	RN125_MOUSE E3 ubiquitin-protein ligase RNF125 OS=Mus musculus OX=10090 GN=Rnf125 PE=2 SV=3
15	Q96EQ8	8.95e-06	48.9	232	0.062	0.121	RN125_HUMAN E3 ubiquitin-protein ligase RNF125 OS=Homo sapiens OX=9606 GN=RNF125 PE=1 SV=4
16	Q96F44	9.94e-06	50.1	468	0.047	0.045	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
17	Q99PQ2	1.23e-05	49.7	467	0.042	0.041	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1
18	Q9UPQ4	1.28e-05	49.7	493	0.060	0.055	TRI35_HUMAN E3 ubiquitin-protein ligase TRIM35 OS=Homo sapiens OX=9606 GN=TRIM35 PE=1 SV=2
19	Q9C037	1.57e-05	49.7	500	0.044	0.040	TRIM4_HUMAN E3 ubiquitin-protein ligase TRIM4 OS=Homo sapiens OX=9606 GN=TRIM4 PE=1 SV=2
20	H0YGS7	1.75e-05	48.5	244	0.053	0.098	H0YGS7_HUMAN Tripartite motif containing 65 (Fragment) OS=Homo sapiens OX=9606 GN=TRIM65 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00536 SAM_1	1.2e-05	36.9	SAM domain (Sterile alpha motif)
2	PF07647 SAM_2	0.17	23.4	SAM domain (Sterile alpha motif)
3	PF02198 SAM_PNT	22	16.4	Sterile alpha motif (SAM)/Pointed domain
4	PF12861 zf-ANAPC11	36	15.8	Anaphase-promoting complex subunit 11 RING-H2 finger
5	PF00097 zf-C3HC4	0.00014	33.0	Zinc finger, C3HC4 type (RING finger)
6	PF13923 zf-C3HC4_2	0.00088	30.4	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	0.0089	27.2	Zinc finger, C3HC4 type (RING finger)
8	PF15227 zf-C3HC4_4	5.3e-05	34.6	zinc finger of C3HC4-type, RING
9	PF12678 zf-rbx1	2.2e+02	13.6	RING-H2 zinc finger domain
10	PF16685 zf-RING_10	75	14.9	zinc RING finger of MSL2
11	PF13639 zf-RING_2	0.048	25.3	Ring finger domain
12	PF14634 zf-RING_5	66	14.9	zinc-RING finger domain
13	PF13445 zf-RING_UBOX	0.023	26.1	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261658

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379691	0.909	Pyridoxal-dependent decarboxylase domain-containing protein 1
2	9606.ENSP00000287667	0.764	Nodal modulator 1
3	9606.ENSP00000362179	0.732	Endoribonuclease ZC3H12A
4	9606.ENSP00000389277	0.659	Bax inhibitor 1
5	9606.ENSP00000349324	0.648	Tumor necrosis factor receptor superfamily member 10C
6	9606.ENSP00000351273	0.614	Caspase-8
7	9606.ENSP00000369431	0.600	Caspase activity and apoptosis inhibitor 1
8	9606.ENSP00000172229	0.586	Tumor necrosis factor receptor superfamily member 16
9	9606.ENSP00000367263	0.574	Neuroblast differentiation-associated protein AHNAK
10	9606.ENSP00000295121	0.535	Uncharacterized protein DKFZp434B156
11	9606.ENSP00000228918	0.530	Tumor necrosis factor receptor superfamily member 3
12	9606.ENSP00000373370	0.520	Filaggrin-2
13	9606.ENSP00000387710	0.503	Threonine--tRNA ligase, cytoplasmic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030674	1.000	protein-macromolecule adaptor activity
GO:0089720	1.000	caspase binding
GO:0061630	0.999	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0043067	0.977	regulation of programmed cell death
GO:0009966	0.977	regulation of signal transduction
GO:0048523	0.975	negative regulation of cellular process
GO:0019538	0.975	protein metabolic process
GO:0042981	0.965	regulation of apoptotic process
GO:0043069	0.963	negative regulation of programmed cell death
GO:0043412	0.947	macromolecule modification
GO:0009968	0.943	negative regulation of signal transduction
GO:0080135	0.933	regulation of cellular response to stress
GO:0000209	0.929	protein polyubiquitination
GO:1905897	0.921	regulation of response to endoplasmic reticulum stress
GO:0043066	0.902	negative regulation of apoptotic process
GO:0070936	0.902	protein K48-linked ubiquitination
GO:0051865	0.895	protein autoubiquitination
GO:0006508	0.856	proteolysis
GO:1900101	0.851	regulation of endoplasmic reticulum unfolded protein response
GO:0044237	0.840	cellular metabolic process
GO:1903573	0.786	negative regulation of response to endoplasmic reticulum stress
GO:0044260	0.738	cellular macromolecule metabolic process
GO:0070534	0.708	protein K63-linked ubiquitination
GO:0009057	0.656	macromolecule catabolic process
GO:0051603	0.588	proteolysis involved in protein catabolic process
GO:0044265	0.576	cellular macromolecule catabolic process
GO:0006511	0.566	ubiquitin-dependent protein catabolic process
GO:0043161	0.528	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0050896	0.334	response to stimulus
GO:0048518	0.329	positive regulation of biological process
GO:0019222	0.326	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005783	0.993	endoplasmic reticulum
GO:0031090	0.511	organelle membrane
GO:0005634	0.312	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]