StarFunc result for job id Q9NZU7

User Input

>input (370 residues)
MGGGDGAAFKRPGDGARLQRVLGLGSRREPRSLPAGGPAPRRTAPPPPGHASAGPAAMSS
HIAKSESKTSLLKAAAAAASGGSRAPRHGPARDPGLPSRRLPGSCPATPQSSGDPSSRRP
LCRPAPREEGARGSQRVLPQAHCRPREALPAAASRPSPSSPLPPARGRDGEERGLSPALG
LRGSLRARGRGDSVPAAASEADPFLHRLRPMLSSAFGQDRSLRPEEIEELREAFREFDKD
KDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKLLAETAD
MIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVD
FEEFVRMMSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZU7	1.000	1.000	1.277E-49	370	1.000	1.000	Q9NZU7.pdb.gz	CABP1_HUMAN Calcium-binding protein 1 OS=Homo sapiens OX=9606 GN=CABP1 PE=1 SV=5
2	AFDB:Q9JLK7	0.257	0.397	2.203E-22	227	0.422	0.687	Q9JLK7.pdb.gz	CABP1_MOUSE Calcium-binding protein 1 OS=Mus musculus OX=10090 GN=Cabp1 PE=1 SV=3
3	AFDB:Q8VHC5	0.337	0.433	3.967E-17	271	0.324	0.443	Q8VHC5.pdb.gz	CABP4_MOUSE Calcium-binding protein 4 OS=Mus musculus OX=10090 GN=Cabp4 PE=1 SV=1
4	PDB:1osaA	0.216	0.436	1.117E-10	148	0.165	0.412	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
5	PDB:1ggzA	0.233	0.444	1.453E-10	144	0.168	0.431	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
6	PDB:5a2hA	0.235	0.450	1.793E-10	147	0.159	0.401	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
7	PDB:6ya9A	0.201	0.187	2.592E-10	400	0.165	0.152	6ya9A.pdb.gz	Genetically encoded photo-switchable molecular sensors for optoacoustic and super-resolution imaging.
8	PDB:6xu4A	0.194	0.185	8.693E-10	389	0.143	0.136	6xu4A.pdb.gz	FGCaMP7, an Improved Version of Fungi-Based Ratiometric Calcium Indicator for In Vivo Visualization of Neuronal Activity.
9	PDB:6hr1A	0.186	0.171	1.073E-9	406	0.165	0.150	6hr1A.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.
10	PDB:6xyrA	0.189	0.200	1.816E-9	348	0.168	0.178	6xyrA.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.
11	PDB:2ggmA	0.201	0.472	3.239E-9	149	0.127	0.315	2ggmA.pdb.gz	The structure of the human centrin 2-xeroderma pigmentosum group C protein complex.
12	PDB:2f2pA	0.235	0.407	4.934E-9	169	0.165	0.361	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
13	PDB:3qrxA	0.215	0.422	4.934E-9	145	0.130	0.331	3qrxA.pdb.gz	The structure, molecular dynamics, and energetics of centrin-melittin complex.
14	AFDB:Q9LM78	0.156	0.060	4.355E-1	1019	0.154	0.056	Q9LM78.pdb.gz	Q9LM78_ARATH Calcium-binding EF hand family protein OS=Arabidopsis thaliana OX=3702 GN=ATEH1 PE=1 SV=1
15	AFDB:Q54F44	0.138	0.056	6.294E-1	1142	0.114	0.037	Q54F44.pdb.gz	NOXC_DICDI Superoxide-generating NADPH oxidase heavy chain subunit C OS=Dictyostelium discoideum OX=44689 GN=noxC PE=2 SV=1
16	AFDB:F4HY32	0.174	0.060	1.461	1247	0.111	0.033	F4HY32.pdb.gz	F4HY32_ARATH Calcium-binding EF hand family protein OS=Arabidopsis thaliana OX=3702 GN=ATEH2 PE=1 SV=1
17	AFDB:Q5XXA9	0.094	0.068	1.623	579	0.127	0.081	Q5XXA9.pdb.gz	PSIP1_CHICK Lens epithelium-derived growth factor OS=Gallus gallus OX=9031 GN=PSIP1 PE=2 SV=1
18	AFDB:O08856	0.085	0.063	2.472	602	0.170	0.105	O08856.pdb.gz	ELL_MOUSE RNA polymerase II elongation factor ELL OS=Mus musculus OX=10090 GN=Ell PE=2 SV=2
19	AFDB:P55199	0.078	0.059	2.605	621	0.178	0.106	P55199.pdb.gz	ELL_HUMAN RNA polymerase II elongation factor ELL OS=Homo sapiens OX=9606 GN=ELL PE=1 SV=1
20	AFDB:Q9N554	0.081	0.056	2.746	678	0.146	0.080	Q9N554.pdb.gz	Q9N554_CAEEL OCEL domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ell-1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88751	0.0	514	298	0.732	0.909	CABP1_RAT Calcium-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Cabp1 PE=1 SV=2
2	Q9NZU7	0.0	726	370	1.000	1.000	CABP1_HUMAN Calcium-binding protein 1 OS=Homo sapiens OX=9606 GN=CABP1 PE=1 SV=5
3	Q9JLK7	5.90e-108	317	227	0.411	0.670	CABP1_MOUSE Calcium-binding protein 1 OS=Mus musculus OX=10090 GN=Cabp1 PE=1 SV=3
4	Q9NPB3	3.94e-79	244	220	0.324	0.545	CABP2_HUMAN Calcium-binding protein 2 OS=Homo sapiens OX=9606 GN=CABP2 PE=1 SV=4
5	Q9JLK4	3.58e-77	238	216	0.319	0.546	CABP2_MOUSE Calcium-binding protein 2 OS=Mus musculus OX=10090 GN=Cabp2 PE=1 SV=3
6	Q9NP86	6.32e-77	236	173	0.303	0.647	CABP5_HUMAN Calcium-binding protein 5 OS=Homo sapiens OX=9606 GN=CABP5 PE=1 SV=1
7	P57796	4.40e-67	215	275	0.270	0.364	CABP4_HUMAN Calcium-binding protein 4 OS=Homo sapiens OX=9606 GN=CABP4 PE=1 SV=2
8	Q8VHC5	6.85e-58	191	271	0.257	0.351	CABP4_MOUSE Calcium-binding protein 4 OS=Mus musculus OX=10090 GN=Cabp4 PE=1 SV=1
9	P02599	7.55e-33	122	152	0.168	0.408	CALM_DICDI Calmodulin OS=Dictyostelium discoideum OX=44689 GN=calA PE=1 SV=3
10	P24044	1.18e-32	121	149	0.176	0.436	CALM_PLAFA Calmodulin OS=Plasmodium falciparum OX=5833 GN=CAM PE=1 SV=4
11	P62203	1.18e-32	121	149	0.176	0.436	CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=CAM PE=1 SV=2
12	G1NK53	1.53e-32	121	148	0.168	0.419	G1NK53_MELGA Calmodulin 1 OS=Meleagris gallopavo OX=9103 GN=CALM1 PE=4 SV=1
13	B4DJ51	1.71e-32	120	149	0.168	0.416	B4DJ51_HUMAN Calmodulin 1 (Phosphorylase kinase, delta), isoform CRA_a OS=Homo sapiens OX=9606 GN=HEL-S-72 PE=1 SV=1
14	P0DP23	1.71e-32	120	149	0.168	0.416	CALM1_HUMAN Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1
15	P0DP24	1.71e-32	120	149	0.168	0.416	CALM2_HUMAN Calmodulin-2 OS=Homo sapiens OX=9606 GN=CALM2 PE=1 SV=1
16	P0DP25	1.71e-32	120	149	0.168	0.416	CALM3_HUMAN Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1
17	P0DP26	1.71e-32	120	149	0.168	0.416	CALM1_MOUSE Calmodulin-1 OS=Mus musculus OX=10090 GN=Calm1 PE=1 SV=1
18	P0DP27	1.71e-32	120	149	0.168	0.416	CALM2_MOUSE Calmodulin-2 OS=Mus musculus OX=10090 GN=Calm2 PE=1 SV=1
19	P0DP28	1.71e-32	120	149	0.168	0.416	CALM3_MOUSE Calmodulin-3 OS=Mus musculus OX=10090 GN=Calm3 PE=1 SV=1
20	P0DP29	1.71e-32	120	149	0.168	0.416	CALM1_RAT Calmodulin-1 OS=Rattus norvegicus OX=10116 GN=Calm1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05042 Caleosin	3e+02	12.7	Caleosin related protein
2	PF16844 DIMCO_N	41	16.0	Dinitrogenase iron-molybdenum cofactor, N-terminal
3	PF00404 Dockerin_1	1.7	20.2	Dockerin type I domain
4	PF00036 EF-hand_1	1.8e-26	100.7	EF hand
5	PF12763 EF-hand_4	1.5e+02	13.8	Cytoskeletal-regulatory complex EF hand
6	PF13202 EF-hand_5	3.4e-16	69.1	EF hand
7	PF13405 EF-hand_6	2.3e-20	81.6	EF-hand domain
8	PF13499 EF-hand_7	4.7e-23	92.7	EF-hand domain pair
9	PF13833 EF-hand_8	1.7e-16	71.1	EF-hand domain pair
10	PF14658 EF-hand_9	1.3e-05	36.8	EF-hand domain
11	PF08479 POTRA_2	2.6e+02	12.8	POTRA domain, ShlB-type
12	PF10591 SPARC_Ca_bdg	22	16.8	Secreted protein acidic and rich in cysteine Ca binding region
13	PF05099 TerB	59	15.4	Tellurite resistance protein TerB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317310

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378207	0.931	A-kinase anchor protein 5
2	9606.ENSP00000266376	0.868	Voltage-dependent L-type calcium channel subunit alpha-1C
3	9606.ENSP00000353362	0.864	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
4	9606.ENSP00000306253	0.851	Inositol 1,4,5-trisphosphate receptor type 1
5	9606.ENSP00000376609	0.806	G protein-coupled receptor kinase 5
6	9606.ENSP00000361475	0.781	Neuronal calcium sensor 1
7	9606.ENSP00000377784	0.772	Guanylyl cyclase-activating protein 1
8	9606.ENSP00000362566	0.716	Neuron-specific calcium-binding protein hippocalcin
9	9606.ENSP00000365745	0.704	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
10	9606.ENSP00000226193	0.659	Recoverin
11	9606.ENSP00000288235	0.645	Unconventional myosin-Ie
12	9606.ENSP00000353590	0.621	Myosin-10
13	9606.ENSP00000479860	0.609	Calcium and integrin binding 1
14	9606.ENSP00000420237	0.596	M14 carboxypeptidases
15	9606.ENSP00000357869	0.569	Phosphatidylinositol 4-kinase beta
16	9606.ENSP00000281543	0.567	Translation factor GUF1, mitochondrial
17	9606.ENSP00000283550	0.562	Sperm acrosome-associated protein 7
18	9606.ENSP00000369547	0.556	S100 calcium binding protein G
19	9606.ENSP00000363435	0.548	Inositol 1,4,5-trisphosphate receptor type 3
20	9606.ENSP00000288139	0.543	Voltage-dependent L-type calcium channel subunit alpha-1D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005509	1.000	calcium ion binding
GO:0048306	0.999	calcium-dependent protein binding
GO:0098772	0.996	molecular function regulator activity
GO:0030234	0.946	enzyme regulator activity
GO:0140678	0.927	molecular function inhibitor activity
GO:0004857	0.898	enzyme inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0050896	0.979	response to stimulus
GO:0023052	0.947	signaling
GO:0051716	0.930	cellular response to stimulus
GO:0034765	0.916	regulation of monoatomic ion transmembrane transport
GO:0010959	0.912	regulation of metal ion transport
GO:0007154	0.905	cell communication
GO:0051924	0.899	regulation of calcium ion transport
GO:1904062	0.894	regulation of monoatomic cation transmembrane transport
GO:0007267	0.890	cell-cell signaling
GO:0099536	0.876	synaptic signaling
GO:0032412	0.862	regulation of monoatomic ion transmembrane transporter activity
GO:0032880	0.852	regulation of protein localization
GO:1900180	0.831	regulation of protein localization to nucleus
GO:0033157	0.831	regulation of intracellular protein transport
GO:0023051	0.822	regulation of signaling
GO:1903169	0.814	regulation of calcium ion transmembrane transport
GO:1904063	0.814	negative regulation of cation transmembrane transport
GO:0010646	0.789	regulation of cell communication
GO:2001257	0.786	regulation of cation channel activity
GO:1901019	0.769	regulation of calcium ion transmembrane transporter activity
GO:1901385	0.764	regulation of voltage-gated calcium channel activity
GO:0042306	0.746	regulation of protein import into nucleus
GO:0048583	0.730	regulation of response to stimulus
GO:1903828	0.711	negative regulation of protein localization
GO:0032413	0.711	negative regulation of ion transmembrane transporter activity
GO:0007165	0.691	signal transduction
GO:1900181	0.689	negative regulation of protein localization to nucleus
GO:0098926	0.679	postsynaptic signal transduction
GO:1904950	0.650	negative regulation of establishment of protein localization
GO:1901020	0.596	negative regulation of calcium ion transmembrane transporter activity
GO:0032387	0.458	negative regulation of intracellular transport
GO:0051224	0.429	negative regulation of protein transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0030054	0.994	cell junction
GO:0045202	0.972	synapse
GO:0005829	0.942	cytosol
GO:0032279	0.937	asymmetric synapse
GO:0099572	0.937	postsynaptic specialization
GO:0014069	0.932	postsynaptic density
GO:0043228	0.886	non-membrane-bounded organelle
GO:0043232	0.883	intracellular non-membrane-bounded organelle
GO:0031090	0.842	organelle membrane
GO:0031982	0.663	vesicle
GO:0005576	0.621	extracellular region
GO:0098588	0.496	bounding membrane of organelle
GO:0005794	0.496	Golgi apparatus
GO:0005615	0.479	extracellular space
GO:0032991	0.404	protein-containing complex
GO:0005634	0.320	nucleus
GO:0097708	0.304	intracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]