StarFunc result for job id Q9NZV1

User Input

>input (1036 residues)
MYLVAGDRGLAGCGHLLVSLLGLLLLLARSGTRALVCLPCDESKCEEPRNCPGSIVQGVC
GCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLL
GFKPCNENLIAGCNIINGKCECNTIRTCSNPFEFPSQDMCLSALKRIEEEKPDCSKARCE
VQFSPRCPEDSVLIEGYAPPGECCPLPSRCVCNPAGCLRKVCQPGNLNILVSKASGKPGE
CCDLYECKPVFGVDCRTVECPPVQQTACPPDSYETQVRLTADGCCTLPTRCECLSGLCGF
PVCEVGSTPRIVSRGDGTPGKCCDVFECVNDTKPACVFNNVEYYDGDMFRMDNCRFCRCQ
GGVAICFTAQCGEINCERYYVPEGECCPVCEDPVYPFNNPAGCYANGLILAHGDRWREDD
CTFCQCVNGERHCVATVCGQTCTNPVKVPGECCPVCEEPTIITVDPPACGELSNCTLTGK
DCINGFKRDHNGCRTCQCINTEELCSERKQGCTLNCPFGFLTDAQNCEICECRPRPKKCR
PIICDKYCPLGLLKNKHGCDICRCKKCPELSCSKICPLGFQQDSHGCLICKCREASASAG
PPILSGTCLTVDGHHHKNEESWHDGCRECYCLNGREMCALITCPVPACGNPTIHPGQCCP
SCADDFVVQKPELSTPSICHAPGGEYFVEGETWNIDSCTQCTCHSGRVLCETEVCPPLLC
QNPSRTQDSCCPQCTDQPFRPSLSRNNSVPNYCKNDEGDIFLAAESWKPDVCTSCICIDS
VISCFSESCPSVSCERPVLRKGQCCPYCIEDTIPKKVVCHFSGKAYADEERWDLDSCTHC
YCLQGQTLCSTVSCPPLPCVEPINVEGSCCPMCPEMYVPEPTNIPIEKTNHRGEVDLEVP
LWPTPSENDIVHLPRDMGHLQVDYRDNRLHPSEDSSLDSIASVVVPIIICLSIIIAFLFI
NQKKQWIPLLCWYRTPTKPSSLNNQLVSVDCKKGTRVQVDSSQRMLRIAEPDARFSGFYS
MQKQNHLQADNFYQTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7T3Q2	0.297	0.300	0.000	1027	0.695	0.701	Q7T3Q2.pdb.gz	CRIM1_DANRE Cysteine-rich motor neuron 1 protein OS=Danio rerio OX=7955 GN=crim1 PE=2 SV=1
2	AFDB:Q9NZV1	1.000	1.000	0.000	1036	1.000	1.000	Q9NZV1.pdb.gz	CRIM1_HUMAN Cysteine-rich motor neuron 1 protein OS=Homo sapiens OX=9606 GN=CRIM1 PE=1 SV=1
3	PDB:1c1zA	0.037	0.085	3.907E-2	326	0.040	0.126	1c1zA.pdb.gz
4	AFDB:F1QJC9	0.055	0.040	8.510E-2	1447	0.096	0.068	F1QJC9.pdb.gz
5	PDB:2gsxA	0.048	0.051	1.005E-1	951	0.125	0.136	2gsxA.pdb.gz
6	AFDB:Q2LDA1	0.058	0.043	1.124E-1	1491	0.099	0.069	Q2LDA1.pdb.gz	Q2LDA1_DANRE Collagen alpha-1(II) chain precursor OS=Danio rerio OX=7955 GN=col2a1 PE=1 SV=1
7	AFDB:A0A2R8QL73	0.058	0.052	1.256E-1	1217	0.092	0.078	A0A2R8QL73.pdb.gz
8	AFDB:F1LQ00	0.061	0.043	1.256E-1	1494	0.101	0.070	F1LQ00.pdb.gz	F1LQ00_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=1 SV=4
9	AFDB:P02452	0.064	0.047	1.403E-1	1464	0.111	0.079	P02452.pdb.gz	CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens OX=9606 GN=COL1A1 PE=1 SV=6
10	PDB:3ix0B	0.034	0.334	2.731E-1	94	0.012	0.128	3ix0B.pdb.gz
11	AFDB:P12105	0.056	0.046	3.054E-1	1262	0.113	0.093	P12105.pdb.gz	CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus OX=9031 GN=COL3A1 PE=2 SV=2
12	AFDB:F1QDL1	0.063	0.046	3.228E-1	1449	0.104	0.075	F1QDL1.pdb.gz
13	AFDB:Q8CGM2	0.038	0.030	3.608E-1	1859	0.147	0.082	Q8CGM2.pdb.gz	RP1L1_MOUSE Retinitis pigmentosa 1-like 1 protein OS=Mus musculus OX=10090 GN=Rp1l1 PE=1 SV=1
14	PDB:4e0sB	0.040	0.045	6.283E-1	898	0.030	0.035	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
15	PDB:1w0rA	0.039	0.064	1.909	442	0.057	0.133	1w0rA.pdb.gz
16	PDB:8a3tQ	0.044	0.053	1.909	623	0.016	0.027	8a3tQ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
17	PDB:1ebdA	0.024	0.053	2.383	455	0.003	0.007	1ebdA.pdb.gz	Protein-protein interactions in the pyruvate dehydrogenase multienzyme complex: dihydrolipoamide dehydrogenase complexed with the binding domain of dihydrolipoamide acetyltransferase.
18	PDB:2p6aD	0.037	0.082	2.520	292	0.033	0.116	2p6aD.pdb.gz	Structural and biophysical coupling of heparin and activin binding to follistatin isoform functions.
19	PDB:6oemB	0.047	0.082	2.520	346	0.033	0.098	6oemB.pdb.gz	Cutting antiparallel DNA strands in a single active site.
20	PDB:3e3kB	0.021	0.039	2.977	500	0.004	0.008	3e3kB.pdb.gz	Structural characterization of a putative endogenous metal chelator in the periplasmic nickel transporter NikA

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7T3Q2	0.0	1472	1027	0.696	0.702	CRIM1_DANRE Cysteine-rich motor neuron 1 protein OS=Danio rerio OX=7955 GN=crim1 PE=2 SV=1
2	Q9NZV1	0.0	2082	1036	1.000	1.000	CRIM1_HUMAN Cysteine-rich motor neuron 1 protein OS=Homo sapiens OX=9606 GN=CRIM1 PE=1 SV=1
3	G5EF34	4.33e-109	364	966	0.271	0.291	G5EF34_CAEEL Cysteine-rich motor neuron 1 protein-like OS=Caenorhabditis elegans OX=6239 GN=crm-1 PE=1 SV=1
4	Q3U492	1.14e-33	143	1550	0.148	0.099	KCP_MOUSE Kielin/chordin-like protein OS=Mus musculus OX=10090 GN=Kcp PE=1 SV=2
5	Q80T14	3.56e-20	99.8	4010	0.082	0.021	FRAS1_MOUSE Extracellular matrix organizing protein FRAS1 OS=Mus musculus OX=10090 GN=Fras1 PE=1 SV=2
6	A0A0R4IQJ3	1.68e-19	97.8	4003	0.083	0.021	A0A0R4IQJ3_DANRE Extracellular matrix protein FRAS1 isoform X1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=2
7	F1Q633	2.85e-19	97.1	3970	0.079	0.021	F1Q633_DANRE Extracellular matrix protein FRAS1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=1
8	Q8N8U9	1.64e-18	93.2	685	0.125	0.190	BMPER_HUMAN BMP-binding endothelial regulator protein OS=Homo sapiens OX=9606 GN=BMPER PE=1 SV=3
9	Q8CJ69	3.24e-16	85.9	685	0.124	0.187	BMPER_MOUSE BMP-binding endothelial regulator protein OS=Mus musculus OX=10090 GN=Bmper PE=1 SV=1
10	B4XEZ3	4.77e-15	81.3	454	0.087	0.198	B4XEZ3_DANRE Chordin-like 2 OS=Danio rerio OX=7955 GN=CHL PE=2 SV=1
11	Q92832	2.29e-14	80.1	810	0.139	0.178	NELL1_HUMAN Protein kinase C-binding protein NELL1 OS=Homo sapiens OX=9606 GN=NELL1 PE=1 SV=4
12	O57472	2.51e-14	80.1	940	0.072	0.080	CHRD_DANRE Chordin OS=Danio rerio OX=7955 GN=chd PE=2 SV=1
13	Q96DN2	3.56e-14	79.7	955	0.087	0.094	VWCE_HUMAN von Willebrand factor C and EGF domain-containing protein OS=Homo sapiens OX=9606 GN=VWCE PE=1 SV=2
14	Q62919	3.41e-13	76.3	810	0.140	0.179	NELL1_RAT Protein kinase C-binding protein NELL1 OS=Rattus norvegicus OX=10116 GN=Nell1 PE=2 SV=2
15	A6H8K2	1.18e-12	74.3	668	0.069	0.108	A6H8K2_DANRE BMP-binding endothelial regulator protein precursor OS=Danio rerio OX=7955 GN=cvl2 PE=2 SV=1
16	Q9W2H2	1.24e-12	74.3	751	0.059	0.081	Q9W2H2_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2
17	Q9GYX3	1.64e-12	73.9	751	0.059	0.081	Q9GYX3_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2
18	Q76LD0	2.35e-11	69.7	447	0.061	0.141	CRDL1_RAT Chordin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Chrdl1 PE=2 SV=2
19	Q9BU40	3.03e-11	69.3	456	0.069	0.156	CRDL1_HUMAN Chordin-like protein 1 OS=Homo sapiens OX=9606 GN=CHRDL1 PE=1 SV=2
20	Q920C1	7.16e-11	68.2	447	0.061	0.141	CRDL1_MOUSE Chordin-like protein 1 OS=Mus musculus OX=10090 GN=Chrdl1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02822 Antistasin	1.6e-14	65.5	Antistasin family
2	PF19442 CRIM1_C	4.8e-70	245.0	Cysteine-rich motor neuron 1 protein C-terminal
3	PF00219 IGFBP	0.00077	31.3	Insulin-like growth factor binding protein
4	PF00093 VWC	4.2e-34	128.0	von Willebrand factor type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280527

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368547	0.834	Fasciculation and elongation protein zeta-2
2	9606.ENSP00000264265	0.597	Latexin
3	9606.ENSP00000324419	0.591	Synaptotagmin-9
4	9606.ENSP00000227451	0.570	E3 ubiquitin-protein ligase DTX4
5	9606.ENSP00000231721	0.567	Semaphorin-3G
6	9606.ENSP00000259526	0.559	Protein NOV homolog
7	9606.ENSP00000360270	0.549	Metalloendopeptidase OMA1, mitochondrial
8	9606.ENSP00000250160	0.545	WNT1-inducible-signaling pathway protein 1
9	9606.ENSP00000331327	0.543	Wilms tumor protein
10	9606.ENSP00000306772	0.535	LIM domain-binding protein 2
11	9606.ENSP00000476176	0.520	Glucose-6-phosphate exchanger SLC37A4
12	9606.ENSP00000329403	0.518	Calmodulin regulator protein PCP4
13	9606.ENSP00000274382	0.515	Protein limb expression 1 homolog
14	9606.ENSP00000269141	0.510	Cadherin-2
15	9606.ENSP00000346348	0.509	Zinc finger protein 774
16	9606.ENSP00000245451	0.504	Bone morphogenetic protein 4
17	9606.ENSP00000399075	0.504	A-kinase anchor protein inhibitor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.974	catalytic activity
GO:0140096	0.929	catalytic activity, acting on a protein
GO:0016740	0.912	transferase activity
GO:0004672	0.902	protein kinase activity
GO:0004714	0.888	transmembrane receptor protein tyrosine kinase activity
GO:0030165	0.844	PDZ domain binding
GO:0005010	0.571	insulin-like growth factor receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0048856	0.982	anatomical structure development
GO:0032501	0.980	multicellular organismal process
GO:0007275	0.973	multicellular organism development
GO:0048731	0.957	system development
GO:0045667	0.924	regulation of osteoblast differentiation
GO:0090288	0.912	negative regulation of cellular response to growth factor stimulus
GO:0010646	0.897	regulation of cell communication
GO:0009966	0.887	regulation of signal transduction
GO:0048523	0.867	negative regulation of cellular process
GO:0051093	0.840	negative regulation of developmental process
GO:0090092	0.818	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0030510	0.811	regulation of BMP signaling pathway
GO:0045596	0.798	negative regulation of cell differentiation
GO:0009987	0.771	cellular process
GO:0030514	0.738	negative regulation of BMP signaling pathway
GO:0045668	0.476	negative regulation of osteoblast differentiation
GO:0019222	0.345	regulation of metabolic process
GO:0060255	0.326	regulation of macromolecule metabolic process
GO:0050896	0.316	response to stimulus
GO:0048518	0.308	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0071944	0.702	cell periphery
GO:0005576	0.658	extracellular region
GO:0005886	0.621	plasma membrane
GO:0005622	0.416	intracellular anatomical structure
GO:0043227	0.378	membrane-bounded organelle
GO:0043231	0.372	intracellular membrane-bounded organelle
GO:0005737	0.332	cytoplasm
GO:0005615	0.305	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.912	Transferases.
EC:2.7.1.-	0.902	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.10.1	0.888	receptor protein-tyrosine kinase.

[back to server]