StarFunc result for job id Q9NZV8

User Input

>input (630 residues)
MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLE
RYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELA
FFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDTAGESALPTMTARQRVWRAFENPHT
STMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIF
TVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI
FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAA
FWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD
KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHH
LLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRI
PNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISI
PTPPVTTPEGDDRPESPEYSGGNIVRVSAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8UW33	0.686	0.684	3.233E-78	632	0.929	0.926	Q8UW33.pdb.gz	Q8UW33_CHICK Potassium voltage-gated channel subfamily D member 2 OS=Gallus gallus OX=9031 GN=kv4.2 PE=1 SV=1
2	AFDB:Q62897	0.613	0.591	8.556E-69	655	0.763	0.734	Q62897.pdb.gz	KCND3_RAT Potassium voltage-gated channel subfamily D member 3 OS=Rattus norvegicus OX=10116 GN=Kcnd3 PE=1 SV=2
3	AFDB:A0A286Y962	0.632	0.615	4.071E-67	650	0.744	0.722	A0A286Y962.pdb.gz	A0A286Y962_DANRE Potassium voltage-gated channel subfamily D member 3 isoform X1 OS=Danio rerio OX=7955 GN=wu:fi06g01 PE=4 SV=1
4	AFDB:D3ZYK3	0.618	0.601	1.950E-62	650	0.679	0.658	D3ZYK3.pdb.gz	D3ZYK3_RAT Potassium voltage-gated channel, Shal-related family, member 1 OS=Rattus norvegicus OX=10116 GN=Kcnd1 PE=4 SV=1
5	AFDB:P17971	0.623	0.682	1.504E-57	571	0.597	0.658	P17971.pdb.gz	KCNAL_DROME Potassium voltage-gated channel protein Shal OS=Drosophila melanogaster OX=7227 GN=Shal PE=1 SV=2
6	PDB:7f3fA	0.548	0.729	2.097E-54	460	0.721	0.987	7f3fA.pdb.gz
7	PDB:7w6sB	0.541	0.738	3.870E-50	448	0.614	0.864	7w6sB.pdb.gz
8	AFDB:Q98SV4	0.474	0.378	1.354E-32	816	0.298	0.230	Q98SV4.pdb.gz	Q98SV4_ICTPU Delayed rectifier potassium channel Kv2 OS=Ictalurus punctatus OX=7998 GN=kcnb2b PE=2 SV=1
9	AFDB:Q14721	0.437	0.335	2.288E-32	858	0.295	0.217	Q14721.pdb.gz	KCNB1_HUMAN Potassium voltage-gated channel subfamily B member 1 OS=Homo sapiens OX=9606 GN=KCNB1 PE=1 SV=2
10	AFDB:A0A2R8Q685	0.438	0.342	2.640E-32	834	0.292	0.221	A0A2R8Q685.pdb.gz	A0A2R8Q685_DANRE Potassium voltage-gated channel subfamily B member 1 OS=Danio rerio OX=7955 GN=kcnb1 PE=3 SV=1
11	AFDB:Q92953	0.430	0.309	7.536E-32	911	0.311	0.215	Q92953.pdb.gz	KCNB2_HUMAN Potassium voltage-gated channel subfamily B member 2 OS=Homo sapiens OX=9606 GN=KCNB2 PE=1 SV=2
12	AFDB:P97557	0.515	0.632	1.604E-27	503	0.243	0.304	P97557.pdb.gz	KCNV1_RAT Potassium voltage-gated channel subfamily V member 1 OS=Rattus norvegicus OX=10116 GN=Kcnv1 PE=1 SV=1
13	PDB:7sizB	0.399	0.702	5.613E-25	334	0.229	0.431	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
14	PDB:7sszA	0.392	0.637	6.090E-24	362	0.237	0.412	7sszA.pdb.gz
15	PDB:7phhA	0.469	0.710	1.581E-23	396	0.235	0.374	7phhA.pdb.gz
16	PDB:3lutB	0.380	0.575	1.288E-22	390	0.238	0.385	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
17	PDB:7pquA	0.407	0.722	1.124E-19	328	0.213	0.409	7pquA.pdb.gz
18	PDB:2a79B	0.284	0.616	1.186E-16	259	0.190	0.463	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
19	PDB:7bylA	0.272	0.422	7.984E-9	354	0.103	0.184	7bylA.pdb.gz	Structural Basis for the Modulation of Human KCNQ4 by Small-Molecule Drugs.
20	PDB:7vnrA	0.292	0.504	2.144E-7	333	0.081	0.153	7vnrA.pdb.gz	Structural insights into the lipid and ligand regulation of a human neuronal KCNQ channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A286Y962	0.0	947	650	0.738	0.715	A0A286Y962_DANRE Potassium voltage-gated channel subfamily D member 3 isoform X1 OS=Danio rerio OX=7955 GN=wu:fi06g01 PE=4 SV=1
2	D3ZYK3	0.0	852	650	0.675	0.654	D3ZYK3_RAT Potassium voltage-gated channel, Shal-related family, member 1 OS=Rattus norvegicus OX=10116 GN=Kcnd1 PE=4 SV=1
3	P17971	0.0	768	571	0.589	0.650	KCNAL_DROME Potassium voltage-gated channel protein Shal OS=Drosophila melanogaster OX=7227 GN=Shal PE=1 SV=2
4	Q62897	0.0	993	655	0.770	0.740	KCND3_RAT Potassium voltage-gated channel subfamily D member 3 OS=Rattus norvegicus OX=10116 GN=Kcnd3 PE=1 SV=2
5	Q63881	0.0	1304	630	0.990	0.990	KCND2_RAT Potassium voltage-gated channel subfamily D member 2 OS=Rattus norvegicus OX=10116 GN=Kcnd2 PE=1 SV=1
6	Q7ZW36	0.0	952	638	0.735	0.726	Q7ZW36_DANRE Potassium voltage-gated channel subfamily D member 3 precursor OS=Danio rerio OX=7955 GN=wu:fi06g01 PE=2 SV=1
7	Q8UW33	0.0	1221	632	0.938	0.935	Q8UW33_CHICK Potassium voltage-gated channel subfamily D member 2 OS=Gallus gallus OX=9031 GN=kv4.2 PE=1 SV=1
8	Q9NSA2	0.0	849	647	0.679	0.662	KCND1_HUMAN Potassium voltage-gated channel subfamily D member 1 OS=Homo sapiens OX=9606 GN=KCND1 PE=1 SV=2
9	Q9NZV8	0.0	1315	630	1.000	1.000	KCND2_HUMAN Potassium voltage-gated channel subfamily D member 2 OS=Homo sapiens OX=9606 GN=KCND2 PE=1 SV=2
10	Q9UK17	0.0	996	655	0.773	0.744	KCND3_HUMAN Potassium voltage-gated channel subfamily D member 3 OS=Homo sapiens OX=9606 GN=KCND3 PE=1 SV=3
11	Q9Z0V1	0.0	996	655	0.775	0.745	KCND3_MOUSE Potassium voltage-gated channel subfamily D member 3 OS=Mus musculus OX=10090 GN=Kcnd3 PE=1 SV=1
12	Q9Z0V2	0.0	1305	630	0.990	0.990	KCND2_MOUSE Potassium voltage-gated channel subfamily D member 2 OS=Mus musculus OX=10090 GN=Kcnd2 PE=1 SV=1
13	Q92953	2.02e-90	301	911	0.257	0.178	KCNB2_HUMAN Potassium voltage-gated channel subfamily B member 2 OS=Homo sapiens OX=9606 GN=KCNB2 PE=1 SV=2
14	Q63099	3.39e-90	301	907	0.257	0.179	KCNB2_RAT Potassium voltage-gated channel subfamily B member 2 OS=Rattus norvegicus OX=10116 GN=Kcnb2 PE=1 SV=2
15	A0A2R8Q685	3.88e-90	299	834	0.265	0.200	A0A2R8Q685_DANRE Potassium voltage-gated channel subfamily B member 1 OS=Danio rerio OX=7955 GN=kcnb1 PE=3 SV=1
16	Q03717	2.43e-88	295	857	0.254	0.187	KCNB1_MOUSE Potassium voltage-gated channel subfamily B member 1 OS=Mus musculus OX=10090 GN=Kcnb1 PE=1 SV=2
17	P15387	2.53e-88	295	857	0.254	0.187	KCNB1_RAT Potassium voltage-gated channel subfamily B member 1 OS=Rattus norvegicus OX=10116 GN=Kcnb1 PE=1 SV=3
18	Q14721	6.39e-88	293	858	0.252	0.185	KCNB1_HUMAN Potassium voltage-gated channel subfamily B member 1 OS=Homo sapiens OX=9606 GN=KCNB1 PE=1 SV=2
19	E7F8M2	3.40e-87	282	493	0.265	0.339	E7F8M2_DANRE Potassium voltage-gated channel subfamily A member 2 OS=Danio rerio OX=7955 GN=LOC100537815 PE=3 SV=2
20	Q98SV4	5.56e-85	285	816	0.275	0.212	Q98SV4_ICTPU Delayed rectifier potassium channel Kv2 OS=Ictalurus punctatus OX=7998 GN=kcnb2b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02214 BTB_2	5e-25	99.0	BTB/POZ domain
2	PF16017 BTB_3	0.076	24.3	BTB/POZ domain
3	PF11879 DUF3399	3.6e-34	128.4	Domain of unknown function (DUF3399)
4	PF00520 Ion_trans	3.2e-39	146.2	Ion transport protein
5	PF07885 Ion_trans_2	2.3e-10	51.6	Ion channel
6	PF08016 PKD_channel	16	16.4	Polycystin cation channel
7	PF11601 Shal-type	8.1e-10	49.4	Shal-type voltage-gated potassium channels, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333496

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000414886	0.999	Potassium voltage-gated channel interacting protein 1
2	9606.ENSP00000420040	0.999	Kv channel-interacting protein 2
3	9606.ENSP00000367001	0.985	Dipeptidyl aminopeptidase-like protein 6
4	9606.ENSP00000295225	0.981	Calsenilin
5	9606.ENSP00000371587	0.950	Kv channel-interacting protein 4
6	9606.ENSP00000419952	0.934	Voltage-gated potassium channel subunit beta-1
7	9606.ENSP00000382428	0.915	Disks large homolog 4
8	9606.ENSP00000247986	0.904	Kinesin-like protein KIF17
9	9606.ENSP00000341940	0.895	Caveolin-3
10	9606.ENSP00000376855	0.893	Inactive dipeptidyl peptidase 10
11	9606.ENSP00000427120	0.891	Small conductance calcium-activated potassium channel protein 2
12	9606.ENSP00000367323	0.890	Voltage-gated potassium channel subunit beta-2
13	9606.ENSP00000345731	0.863	Disks large homolog 1
14	9606.ENSP00000262186	0.844	Potassium voltage-gated channel subfamily H member 2
15	9606.ENSP00000302719	0.840	Voltage-gated potassium channel subunit beta-3
16	9606.ENSP00000361475	0.838	Neuronal calcium sensor 1
17	9606.ENSP00000271751	0.829	Potassium voltage-gated channel subfamily H member 1
18	9606.ENSP00000290310	0.828	Potassium voltage-gated channel subfamily E member 2
19	9606.ENSP00000321427	0.814	Potassium voltage-gated channel subfamily H member 5
20	9606.ENSP00000352035	0.798	Potassium voltage-gated channel subfamily KQT member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005249	1.000	voltage-gated potassium channel activity
GO:0015271	0.994	outward rectifier potassium channel activity
GO:0005250	0.456	A-type (transient outward) potassium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0042391	0.995	regulation of membrane potential
GO:0055085	0.985	transmembrane transport
GO:0006812	0.985	monoatomic cation transport
GO:0001508	0.983	action potential
GO:0006813	0.983	potassium ion transport
GO:0098660	0.976	inorganic ion transmembrane transport
GO:0034220	0.976	monoatomic ion transmembrane transport
GO:0098655	0.969	monoatomic cation transmembrane transport
GO:0071805	0.953	potassium ion transmembrane transport
GO:0050789	0.557	regulation of biological process
GO:0007154	0.436	cell communication
GO:0023052	0.392	signaling
GO:0050794	0.382	regulation of cellular process
GO:0032501	0.332	multicellular organismal process
GO:0050896	0.329	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098797	0.998	plasma membrane protein complex
GO:0034702	0.996	ion channel complex
GO:0008076	0.992	voltage-gated potassium channel complex
GO:0043226	0.988	organelle
GO:0030054	0.870	cell junction
GO:0005622	0.870	intracellular anatomical structure
GO:0005737	0.776	cytoplasm
GO:0043229	0.709	intracellular organelle
GO:0043231	0.682	intracellular membrane-bounded organelle
GO:0120025	0.618	plasma membrane bounded cell projection
GO:0098590	0.580	plasma membrane region
GO:0036477	0.577	somatodendritic compartment
GO:0043005	0.575	neuron projection
GO:0044297	0.562	cell body
GO:0030425	0.527	dendrite
GO:0045202	0.478	synapse
GO:0043025	0.473	neuronal cell body
GO:0098794	0.392	postsynapse
GO:0012505	0.380	endomembrane system
GO:0097060	0.368	synaptic membrane
GO:0099572	0.316	postsynaptic specialization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]