StarFunc result for job id Q9NZW4

User Input

>input (1301 residues)
MKIITYFCIWAVAWAIPVPQSKPLERHVEKSMNLHLLARSNVSVQDELNASGTIKESGVL
VHEGDRGRQENTQDGHKGEGNGSKWAEVGGKSFSTYSTLANEEGNIEGWNGDTGKAETYG
HDGIHGKEENITANGIQGQVSIIDNAGATNRSNTNGNTDKNTQNGDVGDAGHNEDVAVVQ
EDGPQVAGSNNSTDNEDEIIENSCRNEGNTSEITPQINSKRNGTKEAEVTPGTGEDAGLD
NSDGSPSGNGADEDEDEGSGDDEDEEAGNGKDSSNNSKGQEGQDHGKEDDHDSSIGQNSD
SKEYYDPEGKEDPHNEVDGDKTSKSEENSAGIPEDNGSQRIEDTQKLNHRESKRVENRIT
KESETHAVGKSQDKGIEIKGPSSGNRNITKEVGKGNEGKEDKGQHGMILGKGNVKTQGEV
VNIEGPGQKSEPGNKVGHSNTGSDSNSDGYDSYDFDDKSMQGDDPNSSDESNGNDDANSE
SDNNSSSRGDASYNSDESKDNGNGSDSKGAEDDDSDSTSDTNNSDSNGNGNNGNDDNDKS
DSGKGKSDSSDSDSSDSSNSSDSSDSSDSDSSDSNSSSDSDSSDSDSSDSSDSDSSDSSN
SSDSSDSSDSSDSSDSSDSSDSKSDSSKSESDSSDSDSKSDSSDSNSSDSSDNSDSSDSS
NSSNSSDSSDSSDSSDSSSSSDSSNSSDSSDSSDSSNSSESSDSSDSSDSDSSDSSDSSN
SNSSDSDSSNSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSDSSDSS
NSSDSNDSSNSSDSSDSSNSSDSSNSSDSSDSSDSSDSDSSNSSDSSNSSDSSDSSNSSD
SSDSSDSSDGSDSDSSNRSDSSNSSDSSDSSDSSNSSDSSDSSDSNESSNSSDSSDSSNS
SDSDSSDSSNSSDSSDSSNSSDSSESSNSSDNSNSSDSSNSSDSSDSSDSSNSSDSSNSS
DSSNSSDSSDSNSSDSSDSSNSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSNSSD
SSNSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSD
SSESSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSN
SSDSSDSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSD
SSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSSDSSDSSNSSDSSDSSDSSD
STSDSNDESDSQSKSGNGNNNGSDSDSDSEGSDSNHSTSDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZW4	0.999	0.999	0.000	1301	1.000	1.000	Q9NZW4.pdb.gz	DSPP_HUMAN Dentin sialophosphoprotein OS=Homo sapiens OX=9606 GN=DSPP PE=1 SV=2
2	AFDB:P97399	0.036	0.045	6.878E-48	934	0.443	0.617	P97399.pdb.gz	DSPP_MOUSE Dentin sialophosphoprotein OS=Mus musculus OX=10090 GN=Dspp PE=1 SV=2
3	AFDB:Q62598	0.028	0.047	3.048E-36	687	0.274	0.520	Q62598.pdb.gz	DSPP_RAT Dentin sialophosphoprotein OS=Rattus norvegicus OX=10116 GN=Dspp PE=1 SV=2
4	AFDB:F1QM29	0.030	0.028	1.156E-3	1413	0.103	0.095	F1QM29.pdb.gz	F1QM29_DANRE Retinitis pigmentosa GTPase regulator b OS=Danio rerio OX=7955 GN=rpgrb PE=4 SV=1
5	AFDB:Q57ZC1	0.037	0.053	4.335E-2	867	0.099	0.149	Q57ZC1.pdb.gz	Q57ZC1_TRYB2 Starmaker OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.690 PE=4 SV=1
6	AFDB:Q80W59	0.030	0.046	1.286E-1	755	0.082	0.142	Q80W59.pdb.gz	Q80W59_RAT Histidine-rich calcium binding protein OS=Rattus norvegicus OX=10116 GN=Hrc PE=2 SV=1
7	AFDB:P47035	0.026	0.028	1.541E-1	1189	0.102	0.112	P47035.pdb.gz	NET1_YEAST Nucleolar protein NET1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NET1 PE=1 SV=1
8	AFDB:B2ZZ14	0.029	0.023	1.687E-1	2033	0.144	0.092	B2ZZ14.pdb.gz	B2ZZ14_DANRE Hypothetical microtubule-associated protein 1b OS=Danio rerio OX=7955 GN=map1b PE=2 SV=1
9	AFDB:E2QD98	0.026	0.018	2.023E-1	2020	0.085	0.054	E2QD98.pdb.gz	E2QD98_DROME Stardust, isoform G OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=1
10	AFDB:P32870	0.029	0.020	2.424E-1	2248	0.064	0.037	P32870.pdb.gz	CYA1_DROME Ca(2+)/calmodulin-responsive adenylate cyclase OS=Drosophila melanogaster OX=7227 GN=rut PE=1 SV=2
11	PDB:6wkrC	0.020	0.039	4.829	606	0.009	0.020	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
12	PDB:6tedR	0.014	0.067	5.788	244	0.004	0.020	6tedR.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
13	PDB:7mqaNA	0.015	0.058	6.938	295	0.005	0.024	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NZW4	0.0	2091	1301	1.000	1.000	DSPP_HUMAN Dentin sialophosphoprotein OS=Homo sapiens OX=9606 GN=DSPP PE=1 SV=2
2	Q62598	1.68e-92	315	687	0.181	0.344	DSPP_RAT Dentin sialophosphoprotein OS=Rattus norvegicus OX=10116 GN=Dspp PE=1 SV=2
3	Q8IFL9	2.41e-33	142	1222	0.153	0.163	Q8IFL9_PLAF7 Serine/threonine protein kinase, FIKK family OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0424700 PE=4 SV=1
4	Q586W1	3.27e-17	90.1	1238	0.031	0.032	Q586W1_TRYB2 LIM zinc-binding domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.375 PE=4 SV=1
5	Q38AP5	4.91e-07	57.0	1148	0.141	0.160	Q38AP5_TRYB2 Cysteine-rich, acidic integral membrane protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3510 PE=4 SV=1
6	Q8IEN7	1.65e-06	54.7	561	0.042	0.098	Q8IEN7_PLAF7 FHA domain-containing protein, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1307800 PE=4 SV=1
7	Q8I5K3	6.13e-05	50.1	2329	0.051	0.028	Q8I5K3_PLAF7 Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1221000 PE=4 SV=1
8	Q8I492	4.65e-04	47.4	1434	0.030	0.027	Q8I492_PLAF7 Mature parasite-infected erythrocyte surface antigen OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0500800 PE=4 SV=1
9	B7ZVT7	4.99e-04	47.4	2087	0.069	0.043	B7ZVT7_DANRE Coagulation factor V OS=Danio rerio OX=7955 GN=si:bz20i5.3 PE=2 SV=1
10	M9PEH5	0.006	43.9	20710	0.086	0.005	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
11	M9PEI1	0.007	43.5	21657	0.086	0.005	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	M9PC41	0.017	42.4	22743	0.086	0.005	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	M9PBZ0	0.020	42.0	22830	0.086	0.005	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	M9PC45	0.021	42.0	22300	0.086	0.005	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	M9PB30	0.023	42.0	22949	0.086	0.005	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
16	M9PCJ8	0.028	41.6	14825	0.086	0.008	M9PCJ8_DROME Dumpy, isoform X OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9NCR4	0.029	41.6	15105	0.086	0.007	M9NCR4_DROME Dumpy, isoform J OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9NER8	0.036	41.2	15638	0.086	0.007	M9NER8_DROME Dumpy, isoform I OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	M9PB31	0.050	40.8	20404	0.086	0.005	M9PB31_DROME Dumpy, isoform V OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9PB32	0.053	40.8	19560	0.086	0.006	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382213

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340935	0.891	Dentin matrix acidic phosphoprotein 1
2	9606.ENSP00000283249	0.872	Integrin beta-6
3	9606.ENSP00000379350	0.858	Integrin beta-1
4	9606.ENSP00000416984	0.842	Matrix extracellular phosphoglycoprotein
5	9606.ENSP00000260228	0.834	Matrix metalloproteinase-20
6	9606.ENSP00000226284	0.817	Bone sialoprotein 2
7	9606.ENSP00000261023	0.817	Integrin alpha-V
8	9606.ENSP00000357255	0.784	Osteocalcin
9	9606.ENSP00000370088	0.767	Amelogenin, X isoform
10	9606.ENSP00000360493	0.762	Runt-related transcription factor 2
11	9606.ENSP00000313809	0.742	Ameloblastin
12	9606.ENSP00000378517	0.729	Osteopontin
13	9606.ENSP00000339787	0.728	Long-chain-fatty-acid--CoA ligase 4
14	9606.ENSP00000379383	0.721	Enamelin
15	9606.ENSP00000341013	0.680	Amelotin
16	9606.ENSP00000368104	0.664	Bone morphogenetic protein 2
17	9606.ENSP00000331411	0.650	Fibulin-7
18	9606.ENSP00000281243	0.646	Dihydropteridine reductase
19	9606.ENSP00000264399	0.642	cGMP-dependent protein kinase 2
20	9606.ENSP00000389026	0.642	Cysteine rich secretory protein family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005201	0.998	extracellular matrix structural constituent
GO:0005509	0.998	calcium ion binding
GO:0005518	0.997	collagen binding
GO:0005515	0.453	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042476	0.996	odontogenesis
GO:0042475	0.994	odontogenesis of dentin-containing tooth
GO:0048646	0.920	anatomical structure formation involved in morphogenesis
GO:0009987	0.714	cellular process
GO:0050789	0.699	regulation of biological process
GO:0050794	0.642	regulation of cellular process
GO:0032501	0.461	multicellular organismal process
GO:0048518	0.360	positive regulation of biological process
GO:0007275	0.323	multicellular organism development
GO:0050896	0.314	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005737	1.000	cytoplasm
GO:0031012	0.999	extracellular matrix
GO:0043229	0.929	intracellular organelle
GO:0043227	0.926	membrane-bounded organelle
GO:0043231	0.919	intracellular membrane-bounded organelle
GO:0005615	0.747	extracellular space
GO:0005634	0.675	nucleus
GO:0070013	0.404	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]