StarFunc result for job id Q9P021

User Input

>input (101 residues)
MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRI
CKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q792Q4	0.828	0.828	1.276E-19	101	0.990	0.990	Q792Q4.pdb.gz	CRIPT_RAT Cysteine-rich PDZ-binding protein OS=Rattus norvegicus OX=10116 GN=Cript PE=1 SV=1
2	PDB:7dvq0	0.626	0.632	1.404E-16	100	0.990	1.000	7dvq0.pdb.gz	Structure of the activated human minor spliceosome.
3	AFDB:O59800	0.294	0.091	1.834E-1	354	0.149	0.042	O59800.pdb.gz	SLT11_SCHPO Pre-mRNA-splicing factor cwf5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf5 PE=1 SV=1
4	PDB:6id0O	0.265	0.099	2.276E-1	290	0.129	0.045	6id0O.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
5	AFDB:Q9M2S6	0.253	0.125	2.631E-1	273	0.198	0.073	Q9M2S6.pdb.gz	SDIR1_ARATH E3 ubiquitin-protein ligase SDIR1 OS=Arabidopsis thaliana OX=3702 GN=SDIR1 PE=1 SV=1
6	PDB:6j6gQ	0.298	0.106	5.036E-1	292	0.099	0.034	6j6gQ.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
7	AFDB:Q23664	0.139	0.069	6.259E-1	253	0.149	0.059	Q23664.pdb.gz	Q23664_CAEEL C4H2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=vab-23 PE=1 SV=4
8	PDB:5y88M	0.268	0.155	1.114	182	0.119	0.066	5y88M.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
9	PDB:7egb3	0.202	0.099	1.114	263	0.079	0.030	7egb3.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
10	AFDB:Q9LS14	0.223	0.119	1.115	259	0.228	0.089	Q9LS14.pdb.gz	Q9LS14_ARATH At5g38070 OS=Arabidopsis thaliana OX=3702 GN=At5g38070 PE=2 SV=1
11	AFDB:P38241	0.277	0.080	1.199	364	0.099	0.027	P38241.pdb.gz	SLT11_YEAST Pre-mRNA-splicing factor SLT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ECM2 PE=1 SV=1
12	PDB:5mpsN	0.261	0.127	1.384	227	0.119	0.053	5mpsN.pdb.gz	Structure of a spliceosome remodelled for exon ligation.
13	AFDB:Q8R516	0.238	0.046	1.385	973	0.149	0.015	Q8R516.pdb.gz	MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus OX=10090 GN=Mib2 PE=1 SV=2
14	AFDB:Q9M2U4	0.276	0.164	1.385	183	0.139	0.077	Q9M2U4.pdb.gz	SRS6_ARATH Protein SHI RELATED SEQUENCE 6 OS=Arabidopsis thaliana OX=3702 GN=SRS6 PE=1 SV=1
15	AFDB:Q9LFC0	0.284	0.095	1.489	360	0.139	0.039	Q9LFC0.pdb.gz	HAKAI_ARATH E3 ubiquitin-protein ligase HAKAI homolog OS=Arabidopsis thaliana OX=3702 GN=HAKAI PE=1 SV=1
16	PDB:7abiP	0.246	0.111	1.599	237	0.129	0.055	7abiP.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
17	PDB:5gm6Q	0.284	0.161	1.719	185	0.099	0.054	5gm6Q.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	AFDB:Q9VDQ4	0.177	0.056	1.720	439	0.168	0.039	Q9VDQ4.pdb.gz	Q9VDQ4_DROME Trade embargo OS=Drosophila melanogaster OX=7227 GN=trem PE=1 SV=2
19	PDB:6exnN	0.247	0.105	1.986	242	0.099	0.041	6exnN.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
20	PDB:1imlA	0.196	0.239	2.134	76	0.089	0.118	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P021	2.65e-71	209	101	1.000	1.000	CRIPT_HUMAN Cysteine-rich PDZ-binding protein OS=Homo sapiens OX=9606 GN=CRIPT PE=1 SV=1
2	Q792Q4	2.08e-70	206	101	0.990	0.990	CRIPT_RAT Cysteine-rich PDZ-binding protein OS=Rattus norvegicus OX=10116 GN=Cript PE=1 SV=1
3	A0A087WXG7	0.28	32.0	588	0.168	0.029	A0A087WXG7_HUMAN Cytoplasmic polyadenylation element binding protein 1 OS=Homo sapiens OX=9606 GN=CPEB1 PE=1 SV=1
4	A0A087X171	0.29	32.0	561	0.168	0.030	A0A087X171_HUMAN Cytoplasmic polyadenylation element-binding protein 1 OS=Homo sapiens OX=9606 GN=CPEB1 PE=1 SV=1
5	Q9BZB8	0.30	32.0	566	0.168	0.030	CPEB1_HUMAN Cytoplasmic polyadenylation element-binding protein 1 OS=Homo sapiens OX=9606 GN=CPEB1 PE=1 SV=1
6	A0A024R214	0.31	32.0	626	0.168	0.027	A0A024R214_HUMAN Cytoplasmic polyadenylation element binding protein 1, isoform CRA_c OS=Homo sapiens OX=9606 GN=CPEB1 PE=1 SV=1
7	A4PES2	0.33	31.6	566	0.168	0.030	A4PES2_PIG Cytoplasmic polyadenylation element binding protein 1 OS=Sus scrofa OX=9823 GN=CPEB1 PE=2 SV=1
8	P70166	0.52	31.2	561	0.168	0.030	CPEB1_MOUSE Cytoplasmic polyadenylation element-binding protein 1 OS=Mus musculus OX=10090 GN=Cpeb1 PE=1 SV=1
9	P0C279	0.60	30.8	561	0.168	0.030	CPEB1_RAT Cytoplasmic polyadenylation element-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Cpeb1 PE=1 SV=1
10	Q91572	0.90	30.4	568	0.149	0.026	CPE1A_XENLA Cytoplasmic polyadenylation element-binding protein 1-A OS=Xenopus laevis OX=8355 GN=cpeb1-a PE=1 SV=2
11	D4P8S0	2.0	29.3	488	0.218	0.045	D4P8S0_DANRE Synaptotagmin VIIb OS=Danio rerio OX=7955 GN=syt7 PE=2 SV=1
12	Q9Z1F9	2.8	28.9	638	0.149	0.024	SAE2_MOUSE SUMO-activating enzyme subunit 2 OS=Mus musculus OX=10090 GN=Uba2 PE=1 SV=1
13	Q9I7V4	3.8	28.5	364	0.129	0.036	Q9I7V4_DROME MIP24941p OS=Drosophila melanogaster OX=7227 GN=SP22 PE=2 SV=1
14	A0A0B4KFE3	4.3	28.5	3058	0.238	0.008	A0A0B4KFE3_DROME Toutatis, isoform F OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
15	A0A0B4KEM1	4.5	28.5	3094	0.238	0.008	A0A0B4KEM1_DROME Toutatis, isoform G OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
16	Q9BMQ0	4.7	28.5	3109	0.238	0.008	Q9BMQ0_DROME Toutatis OS=Drosophila melanogaster OX=7227 GN=tou PE=3 SV=1
17	A8DYA3	4.8	28.5	3131	0.238	0.008	A8DYA3_DROME Toutatis, isoform E OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
18	Q96KV7	5.6	28.1	1748	0.158	0.009	WDR90_HUMAN WD repeat-containing protein 90 OS=Homo sapiens OX=9606 GN=WDR90 PE=1 SV=2
19	P20908	6.0	28.1	1838	0.198	0.011	CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens OX=9606 GN=COL5A1 PE=1 SV=3
20	Q9YGX5	6.3	28.1	559	0.139	0.025	CPEB1_DANRE Cytoplasmic polyadenylation element-binding protein 1 OS=Danio rerio OX=7955 GN=cpeb1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10235 Cript	2.9e-32	122.4	Microtubule-associated protein CRIPT
2	PF10217 DUF2039	2.2e+02	13.6	Uncharacterized conserved protein (DUF2039)
3	PF18912 DZR_2	67	14.8	Double zinc ribbon domain
4	PF10764 Gin	2.4e+02	13.1	Inhibitor of sigma-G Gin
5	PF04640 PLATZ	9.1e+02	11.9	PLATZ transcription factor
6	PF12368 Rhodanese_C	3e+02	13.1	Rhodanase C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008821283.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008854076.1	0.911	Discs large MAGUK scaffold protein 4
2	1026970.XP_008842616.1	0.705	Discs large MAGUK scaffold protein 3
3	1026970.XP_008827655.1	0.618	WAS/WASL-interacting protein family member 2
4	1026970.XP_008851323.1	0.609	Chromosome unknown C3orf18 homolog
5	1026970.XP_008820816.1	0.608	G-patch domain containing 11
6	1026970.XP_008828154.1	0.595	Nucleotide binding protein 1
7	1026970.XP_008828150.1	0.580	C-type lectin domain family 16 member A
8	1026970.XP_008825359.1	0.561	TATA element modulatory factor 1
9	1026970.XP_008821316.1	0.560	Transmembrane protein 247
10	1026970.XP_008825357.1	0.544	EGF domain specific O-linked N-acetylglucosamine transferase
11	1026970.XP_008843551.1	0.542	Puromycin-sensitive aminopeptidase-like protein
12	1026970.XP_008843482.1	0.538	39S ribosomal protein L45, mitochondrial
13	1026970.XP_008821277.1	0.537	Tetratricopeptide repeat protein 7A
14	1026970.XP_008821289.1	0.535	ATPase H+ transporting V1 subunit E2
15	1026970.XP_008847095.1	0.530	Translocation associated membrane protein 1
16	1026970.XP_008821275.1	0.526	Multiple coagulation factor deficiency protein 2
17	1026970.XP_008842407.1	0.522	Discs large MAGUK scaffold protein 2
18	1026970.XP_008834725.1	0.518	Complexin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030165	1.000	PDZ domain binding
GO:0097110	0.895	scaffold protein binding
GO:0008017	0.836	microtubule binding
GO:0044877	0.827	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.987	regulation of biological process
GO:0051179	0.980	localization
GO:0016043	0.978	cellular component organization
GO:0050794	0.973	regulation of cellular process
GO:0051641	0.958	cellular localization
GO:0051234	0.954	establishment of localization
GO:0008104	0.935	protein localization
GO:0032879	0.912	regulation of localization
GO:0006996	0.906	organelle organization
GO:0007010	0.838	cytoskeleton organization
GO:0065008	0.831	regulation of biological quality
GO:0007017	0.806	microtubule-based process
GO:0032880	0.773	regulation of protein localization
GO:0033365	0.721	protein localization to organelle
GO:0044087	0.654	regulation of cellular component biogenesis
GO:0097435	0.646	supramolecular fiber organization
GO:0000226	0.646	microtubule cytoskeleton organization
GO:0031122	0.643	cytoplasmic microtubule organization
GO:0051128	0.631	regulation of cellular component organization
GO:0044380	0.586	protein localization to cytoskeleton
GO:1905475	0.450	regulation of protein localization to membrane
GO:0045184	0.397	establishment of protein localization
GO:0050807	0.365	regulation of synapse organization
GO:0072698	0.322	protein localization to microtubule cytoskeleton
GO:0008152	0.316	metabolic process
GO:0033043	0.312	regulation of organelle organization
GO:1901888	0.307	regulation of cell junction assembly
GO:0048518	0.300	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0045202	0.997	synapse
GO:0036477	0.995	somatodendritic compartment
GO:0043198	0.994	dendritic shaft
GO:0032279	0.989	asymmetric synapse
GO:0099572	0.989	postsynaptic specialization
GO:0043025	0.986	neuronal cell body
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0098978	0.985	glutamatergic synapse
GO:0043197	0.982	dendritic spine
GO:0099092	0.982	postsynaptic density, intracellular component
GO:0005737	0.974	cytoplasm
GO:0016020	0.972	membrane
GO:0071944	0.925	cell periphery
GO:0005886	0.922	plasma membrane
GO:0032991	0.739	protein-containing complex
GO:0005829	0.682	cytosol
GO:0031982	0.669	vesicle
GO:0012505	0.569	endomembrane system
GO:0005634	0.479	nucleus
GO:0070013	0.379	intracellular organelle lumen
GO:0097060	0.326	synaptic membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]