StarFunc result for job id Q9P086

User Input

>input (117 residues)
MATYSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVE
AELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVARTCEQMLEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K2A7	0.900	0.900	4.907E-15	117	0.983	0.983	A0A0G2K2A7.pdb.gz	A0A0G2K2A7_RAT Mediator of RNA polymerase II transcription subunit 11 OS=Rattus norvegicus OX=10116 GN=Med11 PE=3 SV=1
2	AFDB:D4ADJ7	0.676	0.591	3.151E-13	135	0.855	0.741	D4ADJ7.pdb.gz	D4ADJ7_RAT Mediator of RNA polymerase II transcription subunit 11 OS=Rattus norvegicus OX=10116 GN=Med11 PE=3 SV=1
3	PDB:7emfK	0.458	0.474	6.015E-11	112	0.949	0.991	7emfK.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
4	AFDB:Q9VVS4	0.637	0.460	2.393E-6	176	0.393	0.261	Q9VVS4.pdb.gz	MED11_DROME Mediator of RNA polymerase II transcription subunit 11 OS=Drosophila melanogaster OX=7227 GN=MED11 PE=1 SV=1
5	AFDB:Q6ID77	0.537	0.546	1.842E-3	115	0.179	0.183	Q6ID77.pdb.gz	MED11_ARATH Mediator of RNA polymerase II transcription subunit 11 OS=Arabidopsis thaliana OX=3702 GN=MED11 PE=1 SV=1
6	PDB:5n9jV	0.505	0.586	4.104E-2	99	0.154	0.182	5n9jV.pdb.gz
7	AFDB:O14010	0.441	0.392	7.394E-2	136	0.128	0.110	O14010.pdb.gz	MED22_SCHPO Mediator of RNA polymerase II transcription subunit 22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=med22 PE=1 SV=1
8	PDB:4h63H	0.451	0.320	9.824E-2	174	0.154	0.103	4h63H.pdb.gz
9	PDB:3aaiA	0.420	0.603	1.681E-1	78	0.085	0.128	3aaiA.pdb.gz
10	AFDB:Q99278	0.517	0.526	1.770E-1	115	0.179	0.183	Q99278.pdb.gz	MED11_YEAST Mediator of RNA polymerase II transcription subunit 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MED11 PE=1 SV=2
11	PDB:4gwpA	0.534	0.556	2.056E-1	112	0.137	0.143	4gwpA.pdb.gz
12	PDB:7emf2	0.324	0.327	2.056E-1	115	0.120	0.122	7emf2.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
13	AFDB:Q7KVW5	0.480	0.072	2.831E-1	927	0.103	0.013	Q7KVW5.pdb.gz	KCNN_DROME Small conductance calcium-activated potassium channel protein OS=Drosophila melanogaster OX=7227 GN=SK PE=2 SV=2
14	PDB:7v2wJ	0.278	0.165	3.075E-1	236	0.111	0.055	7v2wJ.pdb.gz
15	AFDB:Q5SHL1	0.417	0.506	3.463E-1	94	0.111	0.138	Q5SHL1.pdb.gz	Q5SHL1_THET8 Copper homeostasis operon regulatory protein OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=TTHA1719 PE=1 SV=1
16	PDB:1qsdA	0.534	0.603	3.762E-1	102	0.094	0.108	1qsdA.pdb.gz
17	PDB:5oqmk	0.412	0.382	3.762E-1	127	0.103	0.094	5oqmk.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
18	PDB:7lbmn	0.397	0.173	3.762E-1	283	0.137	0.057	7lbmn.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
19	AFDB:O14290	0.399	0.254	4.236E-1	188	0.137	0.085	O14290.pdb.gz	YF14_SCHPO Uncharacterized protein C9E9.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9E9.04 PE=4 SV=1
20	AFDB:C6Y4A7	0.348	0.380	4.844E-1	106	0.179	0.198	C6Y4A7.pdb.gz	EMC5_SCHPO ER membrane protein complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=emc5 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P086	2.81e-82	238	117	1.000	1.000	MED11_HUMAN Mediator of RNA polymerase II transcription subunit 11 OS=Homo sapiens OX=9606 GN=MED11 PE=1 SV=2
2	A0A0G2K2A7	2.92e-81	235	117	0.983	0.983	A0A0G2K2A7_RAT Mediator of RNA polymerase II transcription subunit 11 OS=Rattus norvegicus OX=10116 GN=Med11 PE=3 SV=1
3	Q9D8C6	1.26e-80	233	117	0.974	0.974	MED11_MOUSE Mediator of RNA polymerase II transcription subunit 11 OS=Mus musculus OX=10090 GN=Med11 PE=1 SV=1
4	D4ADJ7	9.85e-69	204	135	0.855	0.741	D4ADJ7_RAT Mediator of RNA polymerase II transcription subunit 11 OS=Rattus norvegicus OX=10116 GN=Med11 PE=3 SV=1
5	Q9VVS4	5.76e-25	94.7	176	0.393	0.261	MED11_DROME Mediator of RNA polymerase II transcription subunit 11 OS=Drosophila melanogaster OX=7227 GN=MED11 PE=1 SV=1
6	A0A5P8DHK4	2.0	30.0	8697	0.128	0.002	A0A5P8DHK4_RAT Nesprin 1 short isoform OS=Rattus norvegicus OX=10116 GN=Syne1 PE=2 SV=1
7	A0A8I5ZJB9	2.0	30.0	8815	0.128	0.002	A0A8I5ZJB9_RAT Spectrin repeat containing, nuclear envelope 1 OS=Rattus norvegicus OX=10116 GN=Syne1 PE=1 SV=1
8	A0A5P8DHN0	2.1	30.0	8815	0.128	0.002	A0A5P8DHN0_RAT Nesprin 1 long isoform OS=Rattus norvegicus OX=10116 GN=Syne1 PE=2 SV=1
9	A0A8I6ABC0	2.1	30.0	8788	0.128	0.002	A0A8I6ABC0_RAT Spectrin repeat containing, nuclear envelope 1 OS=Rattus norvegicus OX=10116 GN=Syne1 PE=1 SV=1
10	Q9CA42	2.5	29.6	1085	0.179	0.019	CRWN3_ARATH Protein CROWDED NUCLEI 3 OS=Arabidopsis thaliana OX=3702 GN=CRWN3 PE=1 SV=1
11	Q19350	4.4	28.9	1722	0.162	0.011	Q19350_CAEEL Drosophila CRumBs homolog OS=Caenorhabditis elegans OX=6239 GN=crb-1 PE=4 SV=1
12	Q6ZWR6	7.9	28.5	8799	0.120	0.002	SYNE1_MOUSE Nesprin-1 OS=Mus musculus OX=10090 GN=Syne1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17522 DUF5446	39	15.8	Family of unknown function (DUF5446)
2	PF10280 Med11	9.7e-10	50.5	Mediator complex protein
3	PF18595 Nuf2_DHR10-like	22	16.5	Nuf2, DHR10-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 132908.ENSPVAP00000003794

Rank	PPI partner	STRING score	Description
1	132908.ENSPVAP00000005750	0.993	Mediator complex subunit 10
2	132908.ENSPVAP00000003403	0.992	Mediator complex subunit 17
3	132908.ENSPVAP00000016599	0.988	Mediator complex subunit 18
4	132908.ENSPVAP00000000016	0.987	Mediator complex subunit 8
5	132908.ENSPVAP00000014161	0.985	Mediator complex subunit 6
6	132908.ENSPVAP00000010484	0.982	Mediator complex subunit 29
7	132908.ENSPVAP00000016245	0.980	Mediator complex subunit 30
8	132908.ENSPVAP00000015638	0.979	Mediator complex subunit 14
9	132908.ENSPVAP00000007177	0.978	Mediator complex subunit 20
10	132908.ENSPVAP00000015351	0.978	Mediator complex subunit 19
11	132908.ENSPVAP00000006161	0.977	Mediator complex subunit 16
12	132908.ENSPVAP00000007947	0.975	Mediator complex subunit 4
13	132908.ENSPVAP00000002968	0.974	Mediator complex subunit 27
14	132908.ENSPVAP00000012596	0.974	Mediator complex subunit 21
15	132908.ENSPVAP00000008030	0.973	Mediator complex subunit 1
16	132908.ENSPVAP00000016075	0.970	Mediator complex subunit 22
17	132908.ENSPVAP00000009651	0.966	Mediator complex subunit 7
18	132908.ENSPVAP00000008073	0.964	Mediator complex subunit 24
19	132908.ENSPVAP00000015567	0.960	Mediator complex subunit 12
20	132908.ENSPVAP00000002266	0.946	Mediator complex subunit 31

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.975	catalytic activity
GO:0061630	0.956	ubiquitin protein ligase activity
GO:0140110	0.316	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.994	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0043170	0.978	macromolecule metabolic process
GO:0006807	0.977	nitrogen compound metabolic process
GO:0016567	0.919	protein ubiquitination
GO:0050789	0.719	regulation of biological process
GO:0050794	0.704	regulation of cellular process
GO:0019222	0.669	regulation of metabolic process
GO:2001141	0.631	regulation of RNA biosynthetic process
GO:0010468	0.626	regulation of gene expression
GO:0006355	0.623	regulation of DNA-templated transcription
GO:0009987	0.610	cellular process
GO:0006357	0.457	regulation of transcription by RNA polymerase II
GO:0048518	0.337	positive regulation of biological process
GO:0048522	0.321	positive regulation of cellular process
GO:0010604	0.311	positive regulation of macromolecule metabolic process
GO:0031325	0.308	positive regulation of cellular metabolic process
GO:0051173	0.307	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0070847	0.959	core mediator complex
GO:0016592	0.914	mediator complex
GO:1902494	0.727	catalytic complex
GO:0140535	0.715	intracellular protein-containing complex
GO:1990234	0.709	transferase complex
GO:0005829	0.450	cytosol
GO:0000151	0.345	ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.960	Transferases.

[back to server]