StarFunc result for job id Q9P0J1

User Input

>input (537 residues)
MPAPTQLFFPLIRNCELSRIYGTACYCHHKHLCCSSSYIPQSRLRYTPHPAYATFCRPKE
NWWQYTQGRRYASTPQKFYLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPAN
APIEDRRSAATCLQTRGMLLGVFDGHAGCACSQAVSERLFYYIAVSLLPHETLLEIENAV
ESGRALLPILQWHKHPNDYFSKEASKLYFNSLRTYWQELIDLNTGESTDIDVKEALINAF
KRLDNDISLEAQVGDPNSFLNYLVLRVAFSGATACVAHVDGVDLHVANTGDSRAMLGVQE
EDGSWSAVTLSNDHNAQNERELERLKLEHPKSEAKSVVKQDRLLGLLMPFRAFGDVKFKW
SIDLQKRVIESGPDQLNDNEYTKFIPPNYHTPPYLTAEPEVTYHRLRPQDKFLVLATDGL
WETMHRQDVVRIVGEYLTGMHHQQPIAVGGYKVTLGQMHGLLTERRTKMSSVFEDQNAAT
HLIRHAVGNNEFGTVDHERLSKMLSLPEELARMYRDDITIIVVQFNSHVVGAYQNQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88483	0.879	0.878	1.073E-95	538	0.974	0.972	O88483.pdb.gz	PDP1_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdp1 PE=1 SV=1
2	AFDB:Q9P2J9	0.787	0.799	1.164E-60	529	0.484	0.491	Q9P2J9.pdb.gz	PDP2_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PDP2 PE=2 SV=2
3	AFDB:Q5DTY5	0.788	0.785	4.562E-60	539	0.492	0.490	Q5DTY5.pdb.gz	Q5DTY5_MOUSE MKIAA1348 protein (Fragment) OS=Mus musculus OX=10090 GN=Pdp2 PE=2 SV=1
4	AFDB:Q9W3Q1	0.716	0.805	8.155E-47	475	0.326	0.368	Q9W3Q1.pdb.gz	Q9W3Q1_DROME GM14286p OS=Drosophila melanogaster OX=7227 GN=Pdp PE=1 SV=1
5	AFDB:Q5B158	0.589	0.533	7.893E-32	596	0.279	0.252	Q5B158.pdb.gz	Q5B158_EMENI Protein phophatase 2C family protein (AFU_orthologue AFUA_1G06860) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05722 PE=4 SV=1
6	AFDB:O14189	0.580	0.697	4.238E-31	444	0.253	0.306	O14189.pdb.gz	PP2C5_SCHPO Protein phosphatase 2C homolog C10F6.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC10F6.17c PE=3 SV=4
7	AFDB:Q12511	0.593	0.559	8.161E-28	572	0.255	0.240	Q12511.pdb.gz	PDP1_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PTC5 PE=1 SV=1
8	AFDB:Q9LQN6	0.507	0.419	4.370E-21	662	0.210	0.171	Q9LQN6.pdb.gz	P2C04_ARATH Probable protein phosphatase 2C 4 OS=Arabidopsis thaliana OX=3702 GN=PLL5 PE=2 SV=1
9	AFDB:Q9LUS8	0.464	0.503	1.328E-19	493	0.175	0.191	Q9LUS8.pdb.gz	P2C40_ARATH Probable protein phosphatase 2C 40 OS=Arabidopsis thaliana OX=3702 GN=At3g16560 PE=1 SV=1
10	AFDB:Q9ZV25	0.467	0.390	2.366E-19	654	0.194	0.159	Q9ZV25.pdb.gz	P2C23_ARATH Probable protein phosphatase 2C 23 OS=Arabidopsis thaliana OX=3702 GN=PLL4 PE=2 SV=1
11	PDB:4oicB	0.380	0.639	6.048E-15	305	0.160	0.282	4oicB.pdb.gz	Identification and characterization of ABA receptors in Oryza sativa
12	PDB:5nzzD	0.363	0.495	7.931E-14	379	0.156	0.222	5nzzD.pdb.gz	The TAB1-p38 alpha complex aggravates myocardial injury and can be targeted by small molecules.
13	PDB:1a6qA	0.419	0.606	3.107E-13	363	0.132	0.196	1a6qA.pdb.gz	Crystal structure of the protein serine/threonine phosphatase 2C at 2.0 A resolution.
14	PDB:7kprA	0.413	0.535	4.985E-13	403	0.169	0.226	7kprA.pdb.gz	Structural basis for the specificity of PPM1H phosphatase for Rab GTPases.
15	PDB:4jndA	0.381	0.489	4.330E-11	408	0.130	0.172	4jndA.pdb.gz	Structural insight into Caenorhabditis elegans sex-determining protein FEM-2.
16	PDB:2pk0A	0.273	0.541	2.767E-8	247	0.097	0.211	2pk0A.pdb.gz	Structure of Streptococcus agalactiae serine/threonine phosphatase. The subdomain conformation is coupled to the binding of a third metal ion
17	PDB:5d2uA	0.260	0.539	1.848E-6	240	0.093	0.208	5d2uA.pdb.gz	Structural and Biochemical Characterization of a Cyanobacterial PP2C Phosphatase Reveals Insights into Catalytic Mechanism and Substrate Recognition
18	PDB:6jkvA	0.261	0.549	2.692E-5	230	0.104	0.243	6jkvA.pdb.gz	Crystal structure of PppA from Pseudomonas aeruginosa, a key regulatory component of type VI secretion systems.
19	PDB:3w40A	0.227	0.539	5.373E-4	199	0.067	0.181	3w40A.pdb.gz	Structure of the RsbX phosphatase involved in the general stress response of Bacillus subtilis
20	PDB:6rreD	0.235	0.284	6.986E-4	427	0.086	0.108	6rreD.pdb.gz	Structural insight into the membrane targeting domain of the Legionella deAMPylase SidD.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88483	0.0	1108	538	0.976	0.974	PDP1_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdp1 PE=1 SV=1
2	O88484	0.0	521	530	0.480	0.487	PDP2_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdp2 PE=2 SV=1
3	P35816	0.0	1107	538	0.980	0.978	PDP1_BOVIN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Bos taurus OX=9913 GN=PDP1 PE=1 SV=1
4	Q3UV70	0.0	1114	538	0.983	0.981	PDP1_MOUSE [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Mus musculus OX=10090 GN=Pdp1 PE=1 SV=1
5	Q9P0J1	0.0	1129	537	1.000	1.000	PDP1_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PDP1 PE=1 SV=3
6	Q9P2J9	1.07e-179	518	529	0.479	0.486	PDP2_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PDP2 PE=2 SV=2
7	Q504M2	2.28e-175	507	532	0.484	0.489	Q504M2_MOUSE Pyruvate dehydrogenase phosphatase catalytic subunit 2 OS=Mus musculus OX=10090 GN=Pdp2 PE=1 SV=1
8	Q5DTY5	4.17e-175	506	539	0.484	0.482	Q5DTY5_MOUSE MKIAA1348 protein (Fragment) OS=Mus musculus OX=10090 GN=Pdp2 PE=2 SV=1
9	Q9W3Q1	8.98e-102	317	475	0.333	0.377	Q9W3Q1_DROME GM14286p OS=Drosophila melanogaster OX=7227 GN=Pdp PE=1 SV=1
10	Q5B158	9.17e-52	188	596	0.294	0.265	Q5B158_EMENI Protein phophatase 2C family protein (AFU_orthologue AFUA_1G06860) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05722 PE=4 SV=1
11	O14189	4.59e-46	169	444	0.246	0.297	PP2C5_SCHPO Protein phosphatase 2C homolog C10F6.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC10F6.17c PE=3 SV=4
12	Q5A388	1.57e-45	170	580	0.272	0.252	Q5A388_CANAL Type 2C protein phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PTC5 PE=3 SV=1
13	Q12511	1.74e-39	153	572	0.227	0.213	PDP1_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PTC5 PE=1 SV=1
14	Q5PNS9	4.04e-20	94.7	400	0.153	0.205	P2C64_ARATH Probable protein phosphatase 2C 64 OS=Arabidopsis thaliana OX=3702 GN=PP2C64 PE=1 SV=1
15	Q501F9	4.76e-19	91.3	370	0.121	0.176	P2C67_ARATH Probable protein phosphatase 2C 67 OS=Arabidopsis thaliana OX=3702 GN=PP2C67 PE=1 SV=1
16	Q9SD12	6.83e-19	90.9	379	0.110	0.156	P2C46_ARATH Probable protein phosphatase 2C 46 OS=Arabidopsis thaliana OX=3702 GN=PP2C46 PE=1 SV=1
17	Q9LHJ9	1.14e-18	90.1	385	0.194	0.270	P2C38_ARATH Probable protein phosphatase 2C 38 OS=Arabidopsis thaliana OX=3702 GN=PP2C38 PE=1 SV=1
18	Q9FKX4	1.24e-17	87.0	385	0.112	0.156	P2C79_ARATH Probable protein phosphatase 2C 79 OS=Arabidopsis thaliana OX=3702 GN=PP2C79 PE=2 SV=1
19	Q0V7V2	2.92e-17	85.9	384	0.166	0.232	P2C42_ARATH Probable protein phosphatase 2C 42 OS=Arabidopsis thaliana OX=3702 GN=PP2C42 PE=1 SV=1
20	Q9LUS8	9.31e-15	79.0	493	0.125	0.136	P2C40_ARATH Probable protein phosphatase 2C 40 OS=Arabidopsis thaliana OX=3702 GN=At3g16560 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00481 PP2C	6.6e-33	126.0	Protein phosphatase 2C
2	PF13672 PP2C_2	8.8	17.4	Protein phosphatase 2C

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379503

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369134	0.980	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
2	9606.ENSP00000227868	0.965	Pyruvate dehydrogenase protein X component, mitochondrial
3	9606.ENSP00000205402	0.963	Dihydrolipoyl dehydrogenase, mitochondrial
4	9606.ENSP00000307241	0.963	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
5	9606.ENSP00000280346	0.955	Dihydrolipoamide S-acetyltransferase
6	9606.ENSP00000295266	0.951	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
7	9606.ENSP00000346255	0.926	Protein phosphatase which positively regulates biosynthesis of the ubiquinone, coenzyme Q . Dephosphorylates the ubiquinone biosynthesis protein COQ7 which is likely to lead to its activation
8	9606.ENSP00000288050	0.884	Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial
9	9606.ENSP00000477341	0.788	Protein phosphatase 1K, mitochondrial
10	9606.ENSP00000220764	0.756	2,4-dienoyl-CoA reductase, mitochondrial
11	9606.ENSP00000387219	0.745	NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
12	9606.ENSP00000262719	0.735	PH domain leucine-rich repeat-containing protein phosphatase 1
13	9606.ENSP00000316605	0.729	Cyclic nucleotide-gated cation channel beta-3
14	9606.ENSP00000377115	0.709	Lipoyltransferase 1, mitochondrial
15	9606.ENSP00000379975	0.706	Integrin-linked protein kinase
16	9606.ENSP00000252603	0.705	6-phosphogluconolactonase
17	9606.ENSP00000369274	0.690	Phosphorylase b kinase regulatory subunit alpha, liver isoform
18	9606.ENSP00000327255	0.675	Protein phosphatase 1A
19	9606.ENSP00000216452	0.670	Phosphatidylinositol N-acetylglucosaminyltransferase subunit H
20	9606.ENSP00000261434	0.664	Lipoyl synthase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005509	1.000	calcium ion binding
GO:0004722	1.000	protein serine/threonine phosphatase activity
GO:0005515	0.979	protein binding
GO:0000287	0.841	magnesium ion binding
GO:0044877	0.811	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0044238	0.995	primary metabolic process
GO:0071704	0.987	organic substance metabolic process
GO:0006807	0.973	nitrogen compound metabolic process
GO:0016311	0.937	dephosphorylation
GO:1901564	0.920	organonitrogen compound metabolic process
GO:0043170	0.862	macromolecule metabolic process
GO:0036211	0.819	protein modification process
GO:0006470	0.585	protein dephosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.932	intracellular organelle lumen
GO:0005759	0.744	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]