StarFunc result for job id Q9P0K7

User Input

>input (980 residues)
MKSLKAKFRKSDTNEWNKNDDRLLQAVENGDAEKVASLLGKKGASATKHDSEGKTAFHLA
AAKGHVECLRVMITHGVDVTAQDTTGHSALHLAAKNSHHECIRKLLQSKCPAESVDSSGK
TALHYAAAQGCLQAVQILCEHKSPINLKDLDGNIPLLLAVQNGHSEICHFLLDHGADVNS
RNKSGRTALMLACEIGSSNAVEALIKKGADLNLVDSLGYNALHYSKLSENAGIQSLLLSK
ISQDADLKTPTKPKQHDQVSKISSERSGTPKKRKAPPPPISPTQLSDVSSPRSITSTPLS
GKESVFFAEPPFKAEISSIRENKDRLSDSTTGADSLLDISSEADQQDLLSLLQAKVASLT
LHNKELQDKLQAKSPKEAEADLSFDSYHSTQTDLGPSLGKPGETSPPDSKSSPSVLIHSL
GKSTTDNDVRIQQLQEILQDLQKRLESSEAERKQLQVELQSRRAELVCLNNTEISENSSD
LSQKLKETQSKYEEAMKEVLSVQKQMKLGLVSPESMDNYSHFHELRVTEEEINVLKQDLQ
NALEESERNKEKVRELEEKLVEREKGTVIKPPVEEYEEMKSSYCSVIENMNKEKAFLFEK
YQEAQEEIMKLKDTLKSQMTQEASDEAEDMKEAMNRMIDELNKQVSELSQLYKEAQAELE
DYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAEDALSEMKSQYSKVLNELTQLKQLV
DAQKENSVSITEHLQVITTLRTAAKEMEEKISNLKEHLASKEVEVAKLEKQLLEEKAAMT
DAMVPRSSYEKLQSSLESEVSVLASKLKESVKEKEKVHSEVVQIRSEVSQVKREKENIQT
LLKSKEQEVNELLQKFQQAQEELAEMKRYAESSSKLEEDKDKKINEMSKEVTKLKEALNS
LSQLSYSTSSSKRQSQQLEALQQQVKQLQNQLAECKKQHQEVISVYRMHLLYAVQGQMDE
DVQKVLKQILTMCKNQSQKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P0K7	1.000	1.000	0.000	980	1.000	1.000	Q9P0K7.pdb.gz	RAI14_HUMAN Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14 PE=1 SV=2
2	AFDB:Q9EP71	0.252	0.253	2.483E-86	979	0.852	0.853	Q9EP71.pdb.gz	RAI14_MOUSE Ankycorbin OS=Mus musculus OX=10090 GN=Rai14 PE=1 SV=1
3	AFDB:Q9BZF9	0.238	0.166	1.453E-31	1416	0.333	0.230	Q9BZF9.pdb.gz	UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=2
4	AFDB:Q8CGB3	0.245	0.172	9.614E-31	1411	0.343	0.238	Q8CGB3.pdb.gz	UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus OX=10090 GN=Uaca PE=1 SV=2
5	AFDB:Q5TYW2	0.218	0.258	1.576E-17	823	0.171	0.204	Q5TYW2.pdb.gz	A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens OX=9606 GN=ANKRD20A1 PE=2 SV=1
6	AFDB:Q69ZU8	0.202	0.273	5.384E-17	712	0.109	0.150	Q69ZU8.pdb.gz	ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus OX=10090 GN=Ankrd6 PE=1 SV=2
7	AFDB:F1RBU2	0.205	0.272	2.684E-16	729	0.108	0.145	F1RBU2.pdb.gz
8	AFDB:Q9ULJ7	0.144	0.101	5.716E-16	1429	0.104	0.071	Q9ULJ7.pdb.gz	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
9	AFDB:A0JP26	0.221	0.365	6.587E-16	581	0.108	0.182	A0JP26.pdb.gz	POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens OX=9606 GN=POTEB3 PE=1 SV=2
10	AFDB:Q9Y2G4	0.210	0.281	7.957E-16	727	0.105	0.142	Q9Y2G4.pdb.gz	ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ANKRD6 PE=2 SV=3
11	PDB:8cs9A	0.218	0.267	2.275E-13	796	0.062	0.077	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:4oauC	0.175	0.234	1.095E-11	692	0.073	0.104	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
13	PDB:2dvwA	0.220	0.902	1.757E-11	229	0.058	0.249	2dvwA.pdb.gz
14	PDB:6v9hC	0.211	0.721	2.149E-10	270	0.053	0.193	6v9hC.pdb.gz
15	PDB:5vkqA	0.181	0.124	2.477E-10	1499	0.067	0.044	5vkqA.pdb.gz
16	PDB:6jd6B	0.164	0.772	1.022E-9	192	0.052	0.266	6jd6B.pdb.gz
17	PDB:1wg0A	0.219	0.810	1.123E-9	243	0.060	0.243	1wg0A.pdb.gz
18	PDB:6aunA	0.192	0.300	8.172E-9	618	0.056	0.089	6aunA.pdb.gz
19	PDB:6mwqA	0.150	0.295	1.510E-8	493	0.058	0.116	6mwqA.pdb.gz
20	PDB:1bd8A	0.140	0.743	3.372E-8	156	0.049	0.308	1bd8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9EP71	0.0	1579	979	0.852	0.853	RAI14_MOUSE Ankycorbin OS=Mus musculus OX=10090 GN=Rai14 PE=1 SV=1
2	Q9P0K7	0.0	1979	980	1.000	1.000	RAI14_HUMAN Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14 PE=1 SV=2
3	Q8CGB3	3.45e-86	305	1411	0.282	0.196	UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus OX=10090 GN=Uaca PE=1 SV=2
4	Q9BZF9	3.70e-81	290	1416	0.281	0.194	UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=2
5	H0YNH8	7.37e-80	286	1401	0.269	0.188	H0YNH8_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=1
6	F5H2B9	1.16e-43	175	1307	0.079	0.059	F5H2B9_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=1
7	Q54KA7	1.29e-25	116	986	0.077	0.076	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
8	F6NJE0	4.52e-25	114	728	0.102	0.137	F6NJE0_DANRE Ankyrin repeat domain 6b OS=Danio rerio OX=7955 GN=ankrd6 PE=4 SV=1
9	Q8IYU2	2.74e-24	112	909	0.058	0.063	HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens OX=9606 GN=HACE1 PE=1 SV=2
10	Q8GZ22	3.63e-24	104	240	0.069	0.283	Q8GZ22_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At2g03430 PE=1 SV=1
11	P53355	4.21e-24	112	1430	0.065	0.045	DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=DAPK1 PE=1 SV=6
12	F8W2M1	6.72e-24	110	904	0.056	0.061	HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio OX=7955 GN=hace1 PE=3 SV=2
13	Q9ULJ7	7.91e-24	111	1429	0.071	0.049	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
14	Q80YE7	8.08e-24	111	1442	0.065	0.044	DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Dapk1 PE=1 SV=3
15	B0S4T9	1.46e-23	109	873	0.081	0.090	B0S4T9_DANRE Espin OS=Danio rerio OX=7955 GN=si:dkey-77h17.1 PE=4 SV=1
16	Q12955	2.85e-23	109	4377	0.068	0.015	ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3
17	Q8NFD2	7.06e-23	107	765	0.067	0.086	ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKK1 PE=1 SV=1
18	Q8N6D5	1.01e-22	102	301	0.059	0.193	ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens OX=9606 GN=ANKRD29 PE=1 SV=2
19	F6NQ86	3.10e-22	101	336	0.059	0.173	F6NQ86_DANRE Fibronectin type III and ankyrin repeat domains 1 OS=Danio rerio OX=7955 GN=fank1 PE=4 SV=1
20	Q69ZU8	3.43e-22	105	712	0.079	0.108	ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus OX=10090 GN=Ankrd6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2.3e-27	105.4	Ankyrin repeat
2	PF12796 Ank_2	3.1e-33	125.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.4e-22	88.2	Ankyrin repeat
4	PF13637 Ank_4	4.9e-28	108.4	Ankyrin repeats (many copies)
5	PF13857 Ank_5	6.3e-26	101.4	Ankyrin repeats (many copies)
6	PF04108 ATG17_like	40	15.1	Autophagy protein ATG17-like domain
7	PF10303 DUF2408	47	16.0	Protein of unknown function (DUF2408)
8	PF06818 Fez1	0.1	24.5	Fez1
9	PF14282 FlxA	36	15.8	FlxA-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000028776

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000001020	0.734	Small ArfGAP2
2	9598.ENSPTRP00000051495	0.714	Ring finger and WD repeat domain 2
3	9598.ENSPTRP00000061085	0.671	Protein associated with topoisomerase II homolog 2 (yeast)
4	9598.ENSPTRP00000010462	0.670	Embryonal Fyn-associated substrate
5	9598.ENSPTRP00000017686	0.669	Syntaxin binding protein 2
6	9598.ENSPTRP00000046760	0.668	Uncharacterized protein
7	9598.ENSPTRP00000003847	0.635	Inter-alpha-trypsin inhibitor heavy chain family, member 5
8	9598.ENSPTRP00000016139	0.603	Mannose receptor, C type 2
9	9598.ENSPTRP00000060185	0.602	Transmembrane protein 233
10	9598.ENSPTRP00000050965	0.598	Protein phosphatase, Mg2+/Mn2+ dependent, 1L
11	9598.ENSPTRP00000022669	0.591	Solute carrier family 23 (Nucleobase transporters), member 2
12	9598.ENSPTRP00000026951	0.564	MCF.2 cell line derived transforming sequence-like 2
13	9598.ENSPTRP00000015260	0.559	Dehydrogenase/reductase (SDR family) member 13
14	9598.ENSPTRP00000026627	0.541	Retinol binding protein 1, cellular
15	9598.ENSPTRP00000016851	0.502	Uncharacterized protein
16	9598.ENSPTRP00000026903	0.501	N-acetylated alpha-linked acidic dipeptidase-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050789	0.978	regulation of biological process
GO:0050794	0.887	regulation of cellular process
GO:0050896	0.444	response to stimulus
GO:0032501	0.388	multicellular organismal process
GO:0048518	0.371	positive regulation of biological process
GO:0008152	0.357	metabolic process
GO:0071840	0.327	cellular component organization or biogenesis
GO:0051716	0.307	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005654	0.989	nucleoplasm
GO:0005829	0.978	cytosol
GO:0043232	0.957	intracellular non-membrane-bounded organelle
GO:0016020	0.764	membrane
GO:0005886	0.408	plasma membrane
GO:0001650	0.407	fibrillar center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]