StarFunc result for job id Q9P0L2

User Input

>input (795 residues)
MSARTPLPTVNERDTENHTSVDGYTEPHIQPTKSSSRQNIPRCRNSITSATDEQPHIGNY
RLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIV
KLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVH
RDLKAENLLLDGDMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDV
WSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRG
SLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDE
VMATYILLGRKPPEFEGGESLSSGNLCQRSRPSSDLNNSTLQSPAHLKVQRSISANQKQR
RFSDHAGPSIPPAVSYTKRPQANSVESEQKEEWDKDVARKLGSTTVGSKSEMTASPLVGP
ERKKSSTIPSNNVYSGGSMARRNTYVCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSV
ASAVPSARPRHQKSMSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPD
RTRFPRGSSSRSTFHGEQLRERRSVAYNGPPASPSHETGAFAHARRGTSTGIISKITSKF
VRRDPSEGEASGRTDTSRSTSGEPKERDKEEGKDSKPRSLRFTWSMKTTSSMDPNDMMRE
IRKVLDANNCDYEQKERFLLFCVHGDARQDSLVQWEMEVCKLPRLSLNGVRFKRISGTSI
AFKNIASKIANELKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8VHJ5	0.727	0.727	0.000	795	0.943	0.943	Q8VHJ5.pdb.gz	MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus OX=10090 GN=Mark1 PE=1 SV=2
2	AFDB:Q7KZI7	0.582	0.588	6.642E-82	788	0.678	0.684	Q7KZI7.pdb.gz	MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
3	AFDB:D4A6T9	0.529	0.558	7.147E-69	752	0.562	0.594	D4A6T9.pdb.gz	D4A6T9_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Mark4 PE=3 SV=1
4	AFDB:A0A0G2JTD8	0.415	0.478	2.302E-56	688	0.508	0.587	A0A0G2JTD8.pdb.gz	A0A0G2JTD8_RAT Microtubule affinity regulating kinase 4 OS=Rattus norvegicus OX=10116 GN=Mark4 PE=4 SV=2
5	AFDB:A1ZBL7	0.422	0.342	4.196E-51	993	0.410	0.328	A1ZBL7.pdb.gz	A1ZBL7_DROME Par-1, isoform H OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
6	AFDB:Q8CFH6	0.390	0.333	3.546E-37	931	0.284	0.243	Q8CFH6.pdb.gz	SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus OX=10090 GN=Sik2 PE=1 SV=1
7	AFDB:Q21017	0.383	0.370	8.846E-36	822	0.258	0.249	Q21017.pdb.gz	KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans OX=6239 GN=kin-29 PE=1 SV=2
8	AFDB:Q9VUV4	0.340	0.314	3.996E-35	861	0.268	0.247	Q9VUV4.pdb.gz	Q9VUV4_DROME Sugar-free frosting, isoform A OS=Drosophila melanogaster OX=7227 GN=sff PE=4 SV=3
9	AFDB:A0A1D8PN61	0.336	0.431	1.361E-32	618	0.236	0.304	A0A1D8PN61.pdb.gz	A0A1D8PN61_CANAL non-specific serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNF1 PE=4 SV=1
10	AFDB:P06782	0.332	0.414	2.487E-32	633	0.220	0.276	P06782.pdb.gz	SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNF1 PE=1 SV=1
11	PDB:7myjC	0.329	0.551	5.610E-29	465	0.205	0.351	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
12	PDB:6b1uA	0.331	0.586	9.363E-28	442	0.175	0.314	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
13	PDB:4zhxA	0.326	0.625	2.314E-27	409	0.167	0.325	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
14	PDB:4rerA	0.329	0.560	1.910E-26	459	0.179	0.309	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
15	PDB:4rewA	0.317	0.607	2.716E-26	411	0.166	0.321	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
16	PDB:5ufuA	0.328	0.695	2.856E-26	369	0.158	0.341	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
17	PDB:5u6yA	0.311	0.530	4.576E-24	459	0.141	0.244	5u6yA.pdb.gz
18	PDB:4d28C	0.307	0.833	3.778E-23	279	0.141	0.401	4d28C.pdb.gz
19	PDB:4cztD	0.303	0.755	1.327E-22	302	0.138	0.364	4cztD.pdb.gz
20	PDB:6byrA	0.313	0.602	2.450E-21	405	0.123	0.242	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTD8	720	744	0.504	0.539	A0A0G2JTD8_RAT Microtubule affinity regulating kinase 4 OS=Rattus norvegicus OX=10116 GN=Mark4 PE=4 SV=2
2	A0A8I6A623	726	688	0.502	0.580	A0A8I6A623_RAT Microtubule affinity regulating kinase 4 OS=Rattus norvegicus OX=10116 GN=Mark4 PE=4 SV=1
3	A1ZBL7	586	993	0.438	0.350	A1ZBL7_DROME Par-1, isoform H OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
4	A1ZBL9	583	1170	0.366	0.249	A1ZBL9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=2
5	D4A6T9	797	752	0.560	0.592	D4A6T9_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Mark4 PE=3 SV=1
6	E1JGM9	587	827	0.366	0.352	E1JGM9_DROME Par-1, isoform S OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
7	E1JGN0	717	1141	0.506	0.352	E1JGN0_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
8	E7ETY4	1032	763	0.682	0.710	E7ETY4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
9	E9PC69	1042	778	0.687	0.702	E9PC69_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=3
10	O08678	1524	793	0.943	0.946	MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus OX=10116 GN=Mark1 PE=1 SV=1
11	O08679	979	722	0.644	0.709	MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus OX=10116 GN=Mark2 PE=1 SV=1
12	P27448	1054	753	0.698	0.737	MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3 PE=1 SV=5
13	Q03141	1051	753	0.696	0.734	MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus OX=10090 GN=Mark3 PE=1 SV=2
14	Q05512	1030	776	0.679	0.696	MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus OX=10090 GN=Mark2 PE=1 SV=3
15	Q6NPA6	586	833	0.366	0.349	Q6NPA6_DROME Par-1, isoform L OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
16	Q7KZI7	1030	788	0.688	0.694	MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
17	Q7YU80	581	1046	0.355	0.270	Q7YU80_DROME Par-1, isoform R OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
18	Q8CIP4	798	752	0.565	0.597	MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus OX=10090 GN=Mark4 PE=1 SV=1
19	Q8VHJ5	1529	795	0.943	0.943	MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus OX=10090 GN=Mark1 PE=1 SV=2
20	Q95U75	716	1075	0.506	0.374	Q95U75_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.099	23.3	ABC1 atypical kinase-like domain
2	PF01636 APH	4.8e+02	12.0	Phosphotransferase enzyme family
3	PF12330 Haspin_kinase	2.5e+02	12.0	Haspin like kinase domain
4	PF02149 KA1	1.6e-16	71.0	Kinase associated domain 1
5	PF06293 Kdo	47	14.8	Lipopolysaccharide kinase (Kdo/WaaP) family
6	PF14531 Kinase-like	0.0046	27.9	Kinase-like
7	PF00069 Pkinase	6e-72	253.8	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	1e-40	151.2	Protein tyrosine and serine/threonine kinase
9	PF01163 RIO1	4	18.5	RIO1 family
10	PF00627 UBA	0.006	27.7	UBA/TS-N domain
11	PF08587 UBA_2	30	16.1	Ubiquitin associated domain (UBA)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000000210

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000009325	0.907	Microtubule-associated protein tau
2	9601.ENSPPYP00000014672	0.772	Microtubule-associated protein 2
3	9601.ENSPPYP00000010446	0.767	Serine/threonine kinase 11
4	9601.ENSPPYP00000012330	0.715	14-3-3 protein beta/alpha
5	9601.ENSPPYP00000015972	0.687	Calcium- and diacylglycerol-independent serine/ threonine- protein kinase that plays a general protective role against apoptotic stimuli, is involved in NF-kappa-B activation, cell survival, differentiation and polarity, and contributes to the regulation of microtubule dynamics in the early secretory pathway. Is necessary for BCR-ABL oncogene-mediated resistance to apoptotic drug in leukemia cells, protecting leukemia cells against drug-induced apoptosis. In cultured neurons, prevents amyloid beta protein-induced apoptosis by interrupting cell death process at a very early step. In gli [...]
6	9601.ENSPPYP00000013101	0.674	Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta
7	9601.ENSPPYP00000015563	0.674	Microtubule-associated protein 4
8	9601.ENSPPYP00000016811	0.622	Spermatogenesis associated 5
9	9601.ENSPPYP00000014820	0.606	Calcium binding protein 39
10	9601.ENSPPYP00000002499	0.605	Uncharacterized protein
11	9601.ENSPPYP00000021077	0.605	14-3-3 protein zeta/delta
12	9601.ENSPPYP00000022918	0.605	Uncharacterized protein
13	9601.ENSPPYP00000009579	0.601	Pseudokinase which, in complex with CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta), binds to and activates STK11/LKB1. Adopts a closed conformation typical of active protein kinases and binds STK11/LKB1 as a pseudosubstrate, promoting conformational change of STK11/LKB1 in an active conformation (By similarity)
14	9601.ENSPPYP00000002312	0.596	Mindbomb E3 ubiquitin protein ligase 2
15	9601.ENSPPYP00000009083	0.589	Kinase suppressor of ras 1
16	9601.ENSPPYP00000000929	0.576	CREB regulated transcription coactivator 2
17	9601.ENSPPYP00000002564	0.572	Par-3 family cell polarity regulator
18	9601.ENSPPYP00000019583	0.571	14-3-3 protein gamma
19	9601.ENSPPYP00000005708	0.569	Kinase suppressor of ras 2
20	9601.ENSPPYP00000024441	0.569	STE20-related kinase adaptor beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0004674	0.996	protein serine/threonine kinase activity
GO:0050321	0.980	tau-protein kinase activity
GO:0046872	0.555	metal ion binding
GO:0000287	0.554	magnesium ion binding
GO:0097159	0.361	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0008152	0.986	metabolic process
GO:0043412	0.975	macromolecule modification
GO:0044238	0.974	primary metabolic process
GO:0044237	0.974	cellular metabolic process
GO:0006807	0.971	nitrogen compound metabolic process
GO:0006793	0.962	phosphorus metabolic process
GO:0050896	0.942	response to stimulus
GO:0016310	0.936	phosphorylation
GO:0036211	0.930	protein modification process
GO:0006468	0.923	protein phosphorylation
GO:0051716	0.772	cellular response to stimulus
GO:0023052	0.718	signaling
GO:0007154	0.718	cell communication
GO:0035556	0.697	intracellular signal transduction
GO:0050793	0.586	regulation of developmental process
GO:0048519	0.561	negative regulation of biological process
GO:0071840	0.485	cellular component organization or biogenesis
GO:0019222	0.485	regulation of metabolic process
GO:0048518	0.484	positive regulation of biological process
GO:0048856	0.479	anatomical structure development
GO:0032501	0.470	multicellular organismal process
GO:0051179	0.463	localization
GO:0048523	0.444	negative regulation of cellular process
GO:0060255	0.439	regulation of macromolecule metabolic process
GO:0048522	0.431	positive regulation of cellular process
GO:0051128	0.430	regulation of cellular component organization
GO:0016043	0.416	cellular component organization
GO:0007275	0.390	multicellular organism development
GO:0051234	0.367	establishment of localization
GO:0031323	0.355	regulation of cellular metabolic process
GO:0048583	0.334	regulation of response to stimulus
GO:0048731	0.320	system development
GO:0080090	0.310	regulation of primary metabolic process
GO:0009893	0.301	positive regulation of metabolic process
GO:0065009	0.300	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0016020	0.996	membrane
GO:0043227	0.986	membrane-bounded organelle
GO:0071944	0.977	cell periphery
GO:0043232	0.976	intracellular non-membrane-bounded organelle
GO:0005886	0.963	plasma membrane
GO:0005829	0.912	cytosol
GO:0042995	0.844	cell projection
GO:0120025	0.834	plasma membrane bounded cell projection
GO:0043231	0.814	intracellular membrane-bounded organelle
GO:0005856	0.802	cytoskeleton
GO:0015630	0.793	microtubule cytoskeleton
GO:0005634	0.789	nucleus
GO:0043005	0.734	neuron projection
GO:0036477	0.657	somatodendritic compartment
GO:0005576	0.499	extracellular region
GO:0097447	0.430	dendritic tree
GO:0030425	0.385	dendrite
GO:0070013	0.382	intracellular organelle lumen
GO:0031981	0.361	nuclear lumen
GO:0005654	0.339	nucleoplasm
GO:0031982	0.322	vesicle
GO:0030054	0.300	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.996	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.26	0.980	[tau protein] kinase.

[back to server]