StarFunc result for job id Q9P0N9

User Input

>input (293 residues)
MTEDSQRNFRSVYYEKVGFRGVEEKKSLEILLKDDRLDTEKLCTFSQRFPLPSMYRALVW
KVLLGILPPHHESHAKVMMYRKEQYLDVLHALKVVRFVSDATPQAEVYLRMYQLESGKLP
RSPSFPLEPDDEVFLAIAKAMEEMVEDSVDCYWITRRFVNQLNTKYRDSLPQLPKAFEQY
LNLEDGRLLTHLRMCSAAPKLPYDLWFKRCFAGCLPESSLQRVWDKVVSGSCKILVFVAV
EILLTFKIKVMALNSAEKITKFLENIPQDSSDAIVSKAIDLWHKHCGTPVHSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9D0K0	0.993	0.993	6.681E-37	293	0.908	0.908	Q9D0K0.pdb.gz	TBCD7_MOUSE TBC1 domain family member 7 OS=Mus musculus OX=10090 GN=Tbc1d7 PE=1 SV=1
2	PDB:4z6yA	0.926	0.993	6.858E-33	273	0.932	1.000	4z6yA.pdb.gz
3	AFDB:Q9VCC4	0.860	0.826	5.417E-16	306	0.321	0.307	Q9VCC4.pdb.gz	Q9VCC4_DROME TBC1 domain family member 7 OS=Drosophila melanogaster OX=7227 GN=TBC1d7 PE=4 SV=3
4	AFDB:Q9NU19	0.668	0.414	1.302E-8	505	0.171	0.099	Q9NU19.pdb.gz	TB22B_HUMAN TBC1 domain family member 22B OS=Homo sapiens OX=9606 GN=TBC1D22B PE=1 SV=3
5	AFDB:Q8WUA7	0.678	0.414	1.417E-8	517	0.164	0.093	Q8WUA7.pdb.gz	TB22A_HUMAN TBC1 domain family member 22A OS=Homo sapiens OX=9606 GN=TBC1D22A PE=1 SV=2
6	AFDB:Q385K7	0.654	0.526	3.918E-8	377	0.171	0.133	Q385K7.pdb.gz	Q385K7_TRYB2 TBC1 domain family member 7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3320 PE=4 SV=1
7	AFDB:Q95RC5	0.636	0.364	4.087E-8	546	0.188	0.101	Q95RC5.pdb.gz	Q95RC5_DROME LD44506p OS=Drosophila melanogaster OX=7227 GN=Tbc1d22 PE=2 SV=1
8	AFDB:O59737	0.674	0.407	7.719E-8	514	0.177	0.101	O59737.pdb.gz	GYP1_SCHPO GTPase-activating protein gyp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp1 PE=3 SV=1
9	AFDB:Q08484	0.621	0.319	3.549E-7	637	0.181	0.083	Q08484.pdb.gz	GYP1_YEAST GTPase-activating protein GYP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GYP1 PE=1 SV=1
10	AFDB:Q5A679	0.600	0.335	9.408E-7	564	0.201	0.105	Q5A679.pdb.gz	Q5A679_CANAL Oxidant-induced cell-cycle arrest protein 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GYP1 PE=3 SV=1
11	AFDB:Q8TC07	0.586	0.274	1.853E-6	691	0.137	0.058	Q8TC07.pdb.gz	TBC15_HUMAN TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15 PE=1 SV=2
12	PDB:6zu0C	0.170	0.134	1.724E-1	426	0.109	0.075	6zu0C.pdb.gz
13	PDB:1h9tA	0.120	0.137	6.690E-1	232	0.106	0.134	1h9tA.pdb.gz	The Structural Basis of Acyl Coenzyme A-Dependent Regulation of the Transcription Factor Fadr
14	PDB:7mezB	0.156	0.099	7.282E-1	547	0.099	0.053	7mezB.pdb.gz
15	PDB:3kcuA	0.115	0.123	7.598E-1	252	0.102	0.119	3kcuA.pdb.gz	Structure of the formate transporter FocA reveals a pentameric aquaporin-like channel
16	PDB:4o7gB	0.111	0.140	1.113	212	0.099	0.137	4o7gB.pdb.gz	Structure and mechanism of a eukaryotic transmembrane ascorbate-dependent oxidoreductase
17	PDB:5zlfB	0.153	0.168	1.318	259	0.082	0.093	5zlfB.pdb.gz	Discovery of Lipophilic Bisphosphonates That Target Bacterial Cell Wall and Quinone Biosynthesis.
18	PDB:7nvoA	0.159	0.178	1.375	249	0.075	0.088	7nvoA.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
19	PDB:3m6eA	0.179	0.163	1.497	333	0.113	0.099	3m6eA.pdb.gz
20	PDB:5wp9A	0.138	0.080	1.497	590	0.099	0.049	5wp9A.pdb.gz	Structural basis of mitochondrial receptor binding and constriction by DRP1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9D0K0	0.0	562	293	0.908	0.908	TBCD7_MOUSE TBC1 domain family member 7 OS=Mus musculus OX=10090 GN=Tbc1d7 PE=1 SV=1
2	Q9P0N9	0.0	607	293	1.000	1.000	TBCD7_HUMAN TBC1 domain family member 7 OS=Homo sapiens OX=9606 GN=TBC1D7 PE=1 SV=1
3	Q9VCC4	2.89e-41	146	306	0.321	0.307	Q9VCC4_DROME TBC1 domain family member 7 OS=Drosophila melanogaster OX=7227 GN=TBC1d7 PE=4 SV=3
4	Q9VMT4	0.007	40.0	509	0.102	0.059	Q9VMT4_DROME GH15768p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7742 PE=1 SV=1
5	Q8TEA7	0.009	40.0	893	0.099	0.032	TBCK_HUMAN TBC domain-containing protein kinase-like protein OS=Homo sapiens OX=9606 GN=TBCK PE=1 SV=4
6	A0A3B3IRT3	0.097	36.6	1054	0.085	0.024	A0A3B3IRT3_HUMAN TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4 PE=1 SV=1
7	Q9W4F8	0.10	36.6	819	0.085	0.031	Q9W4F8_DROME LD42868p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG4041 PE=2 SV=4
8	O60343	0.11	36.6	1298	0.085	0.019	TBCD4_HUMAN TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4 PE=1 SV=2
9	P87234	0.12	36.2	635	0.061	0.028	GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp3 PE=1 SV=1
10	Q4KMP7	0.12	36.6	808	0.096	0.035	TB10B_HUMAN TBC1 domain family member 10B OS=Homo sapiens OX=9606 GN=TBC1D10B PE=1 SV=3
11	A0A8I6AT49	0.14	36.2	1300	0.085	0.019	A0A8I6AT49_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=1
12	D3Z881	0.14	36.2	1245	0.085	0.020	D3Z881_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=4
13	D3ZGN0	0.15	36.2	1308	0.085	0.019	D3ZGN0_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=4
14	A0A8I6ABF1	0.16	36.2	1286	0.085	0.019	A0A8I6ABF1_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=1
15	D4AC16	0.18	35.8	1033	0.072	0.020	D4AC16_RAT TBC1 domain family member 1 OS=Rattus norvegicus OX=10116 GN=Tbc1d1 PE=1 SV=2
16	A0A8I6G5Y5	0.21	35.8	1202	0.072	0.017	A0A8I6G5Y5_RAT TBC1 domain family member 1 OS=Rattus norvegicus OX=10116 GN=Tbc1d1 PE=4 SV=1
17	Q8BYJ6	0.21	35.8	1307	0.082	0.018	TBCD4_MOUSE TBC1 domain family member 4 OS=Mus musculus OX=10090 GN=Tbc1d4 PE=1 SV=2
18	Q9VPW9	0.21	35.8	689	0.096	0.041	Q9VPW9_DROME TBC1 domain family member 23 OS=Drosophila melanogaster OX=7227 GN=TBC1D23 PE=1 SV=2
19	A0A8I6AB45	0.22	35.8	1162	0.072	0.018	A0A8I6AB45_RAT TBC1 domain family member 1 OS=Rattus norvegicus OX=10116 GN=Tbc1d1 PE=4 SV=1
20	Q60949	0.22	35.8	1255	0.072	0.017	TBCD1_MOUSE TBC1 domain family member 1 OS=Mus musculus OX=10090 GN=Tbc1d1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14860 DrrA_P4M	86	14.5	DrrA phosphatidylinositol 4-phosphate binding domain
2	PF00566 RabGAP-TBC	1.3e-07	43.0	Rab-GTPase-TBC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000475727

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219476	0.999	Tuberin
2	9606.ENSP00000298552	0.999	Hamartin
3	9606.ENSP00000262187	0.959	GTP-binding protein Rheb
4	9606.ENSP00000451828	0.912	RAC-alpha serine/threonine-protein kinase
5	9606.ENSP00000379287	0.905	14-3-3 protein zeta/delta
6	9606.ENSP00000307305	0.873	DNA damage-inducible transcript 4 protein
7	9606.ENSP00000263826	0.846	RAC-gamma serine/threonine-protein kinase
8	9606.ENSP00000430684	0.820	Inhibitor of nuclear factor kappa-B kinase subunit beta
9	9606.ENSP00000263025	0.819	Mitogen-activated protein kinase 3
10	9606.ENSP00000324806	0.818	Glycogen synthase kinase-3 beta
11	9606.ENSP00000375892	0.817	RAC-beta serine/threonine-protein kinase
12	9606.ENSP00000346148	0.805	5'-AMP-activated protein kinase catalytic subunit alpha-1
13	9606.ENSP00000360290	0.805	5'-AMP-activated protein kinase catalytic subunit alpha-2
14	9606.ENSP00000215832	0.800	Mitogen-activated protein kinase 1
15	9606.ENSP00000435412	0.760	Ribosomal protein S6 kinase alpha-1
16	9606.ENSP00000460380	0.759	Ubiquitin carboxyl-terminal hydrolase 6
17	9606.ENSP00000427015	0.738	Ribosomal protein S6 kinase alpha-2
18	9606.ENSP00000353549	0.727	Cell division cycle protein 16 homolog
19	9606.ENSP00000368884	0.718	Ribosomal protein S6 kinase alpha-3
20	9606.ENSP00000440207	0.716	TBC1 domain family member 30

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031267	1.000	small GTPase binding
GO:0005096	1.000	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0050790	0.993	regulation of catalytic activity
GO:1902531	0.989	regulation of intracellular signal transduction
GO:0043087	0.977	regulation of GTPase activity
GO:0032006	0.975	regulation of TOR signaling
GO:0032007	0.969	negative regulation of TOR signaling
GO:0043547	0.966	positive regulation of GTPase activity
GO:0090630	0.960	activation of GTPase activity
GO:0050896	0.727	response to stimulus
GO:0048518	0.612	positive regulation of biological process
GO:0019222	0.563	regulation of metabolic process
GO:0051246	0.466	regulation of protein metabolic process
GO:0051128	0.450	regulation of cellular component organization
GO:0009987	0.416	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0032991	0.998	protein-containing complex
GO:0031982	0.997	vesicle
GO:0005856	0.996	cytoskeleton
GO:0120025	0.995	plasma membrane bounded cell projection
GO:0005815	0.993	microtubule organizing center
GO:0031410	0.988	cytoplasmic vesicle
GO:0036064	0.984	ciliary basal body
GO:0016020	0.436	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]