StarFunc result for job id Q9P0P8

User Input

>input (240 residues)
MAMASVKLLAGVLRKPDAWIGLWGVLRGTPSSYKLCTSWNRYLYFSSTKLRAPNYKTLFY
NIFSLRLPGLLLSPECIFPFSVRLKSNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEE
ELEDDPTVVKNYKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYKGELRLNEEKLWKKSR
TVKVGDTLDLLIGEDKEAGTETVMRILLKKVFEEKTESEKYRVVLRRWKSLKLPKKRMSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P0P8	1.000	1.000	6.760E-40	240	1.000	1.000	Q9P0P8.pdb.gz	MRES1_HUMAN Mitochondrial transcription rescue factor 1 OS=Homo sapiens OX=9606 GN=MTRES1 PE=1 SV=1
2	AFDB:Q9CQF4	0.516	0.516	6.887E-32	240	0.792	0.792	Q9CQF4.pdb.gz	MRES1_MOUSE Mitochondrial transcription rescue factor 1 OS=Mus musculus OX=10090 GN=Mtres1 PE=1 SV=1
3	PDB:7a5hG	0.380	0.907	1.030E-10	96	0.396	0.990	7a5hG.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
4	PDB:4igvA	0.129	0.166	3.499E-3	149	0.079	0.128	4igvA.pdb.gz
5	PDB:7dmeA	0.163	0.138	1.982E-2	308	0.092	0.071	7dmeA.pdb.gz
6	PDB:3rt0C	0.168	0.214	2.357E-2	172	0.058	0.081	3rt0C.pdb.gz	The Molecular Basis of ABA-Independent Inhibition of PP2Cs by a Subclass of PYL Proteins
7	PDB:4n0gC	0.146	0.211	2.357E-2	145	0.071	0.117	4n0gC.pdb.gz	Molecular basis for the selective and ABA-independent inhibition of PP2CA by PYL13
8	PDB:3k3kB	0.130	0.155	2.497E-2	183	0.062	0.082	3k3kB.pdb.gz	Structural mechanism of abscisic acid binding and signaling by dimeric PYR1.
9	PDB:1dm9B	0.242	0.504	3.147E-2	107	0.083	0.187	1dm9B.pdb.gz
10	PDB:5datS4	0.186	0.172	3.533E-2	260	0.067	0.062	5datS4.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
11	PDB:3w9rA	0.156	0.200	3.965E-2	171	0.058	0.082	3w9rA.pdb.gz	Mechanism of high-affinity abscisic acid binding to PYL9/RCAR1.
12	PDB:3ojiB	0.134	0.159	4.997E-2	185	0.079	0.103	3ojiB.pdb.gz	Complex Structures of the Abscisic Acid Receptor PYL3/RCAR13 Reveal a Unique Regulatory Mechanism
13	AFDB:Q9VUV4	0.231	0.085	7.279E-2	861	0.108	0.030	Q9VUV4.pdb.gz	Q9VUV4_DROME Sugar-free frosting, isoform A OS=Drosophila melanogaster OX=7227 GN=sff PE=4 SV=3
14	AFDB:A1ZBC4	0.161	0.042	9.718E-2	1471	0.158	0.026	A1ZBC4.pdb.gz	A1ZBC4_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Sik3 PE=3 SV=2
15	AFDB:A0A1B0GUD6	0.157	0.062	1.030E-1	877	0.138	0.038	A0A1B0GUD6.pdb.gz	A0A1B0GUD6_HUMAN GRAM domain containing 1B OS=Homo sapiens OX=9606 GN=GRAMD1B PE=1 SV=1
16	AFDB:Q9M2S3	0.154	0.130	1.375E-1	310	0.108	0.084	Q9M2S3.pdb.gz	AHL15_ARATH AT-hook motif nuclear-localized protein 15 OS=Arabidopsis thaliana OX=3702 GN=AHL15 PE=2 SV=1
17	AFDB:P34244	0.165	0.040	1.543E-1	1518	0.104	0.016	P34244.pdb.gz	HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSL1 PE=1 SV=2
18	AFDB:A7TUG5	0.106	0.083	2.450E-1	340	0.129	0.091	A7TUG5.pdb.gz	A7TUG5_GOSHI AT-hook motif nuclear-localized protein OS=Gossypium hirsutum OX=3635 GN=AT1 PE=2 SV=1
19	AFDB:Q12263	0.171	0.051	2.751E-1	1142	0.121	0.025	Q12263.pdb.gz	GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIN4 PE=1 SV=1
20	AFDB:Q9FLX8	0.129	0.104	2.914E-1	348	0.129	0.089	Q9FLX8.pdb.gz	WRK27_ARATH Probable WRKY transcription factor 27 OS=Arabidopsis thaliana OX=3702 GN=WRKY27 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P0P8	7.47e-176	484	240	1.000	1.000	MRES1_HUMAN Mitochondrial transcription rescue factor 1 OS=Homo sapiens OX=9606 GN=MTRES1 PE=1 SV=1
2	Q9CQF4	1.19e-118	340	240	0.767	0.767	MRES1_MOUSE Mitochondrial transcription rescue factor 1 OS=Mus musculus OX=10090 GN=Mtres1 PE=1 SV=1
3	P74082	0.016	38.1	259	0.125	0.116	P74082_SYNY3 Sll1252 protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1252 PE=4 SV=1
4	Q93YQ0	0.099	35.8	320	0.108	0.081	Q93YQ0_ARATH At1g53120 OS=Arabidopsis thaliana OX=3702 GN=F10L8.3 PE=1 SV=1
5	Q9UGR2	2.0	32.0	977	0.142	0.035	Z3H7B_HUMAN Zinc finger CCCH domain-containing protein 7B OS=Homo sapiens OX=9606 GN=ZC3H7B PE=1 SV=2
6	Q6S7F2	4.9	30.8	904	0.117	0.031	E2F7_MOUSE Transcription factor E2F7 OS=Mus musculus OX=10090 GN=E2f7 PE=1 SV=1
7	Q04746	5.0	30.8	504	0.108	0.052	KAR5_YEAST Nuclear fusion protein KAR5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KAR5 PE=1 SV=1
8	G5EBG7	8.2	30.0	467	0.121	0.062	G5EBG7_CAEEL Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05291 Bystin	7.4e+02	10.8	Bystin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384867

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000411268	0.780	BEN domain-containing protein 3
2	9606.ENSP00000230588	0.744	Meprin A subunit alpha
3	9606.ENSP00000291458	0.719	Coiled-coil domain containing 58
4	9606.ENSP00000323635	0.718	Protein FAM210A
5	9606.ENSP00000384331	0.664	Protein CEBPZOS
6	9606.ENSP00000301585	0.643	Peptidyl-tRNA hydrolase ICT1, mitochondrial
7	9606.ENSP00000362085	0.642	UPF0184 protein C9orf16
8	9606.ENSP00000358059	0.640	Reticulon-4-interacting protein 1, mitochondrial
9	9606.ENSP00000429168	0.631	Kidney mitochondrial carrier protein 1
10	9606.ENSP00000318900	0.625	Sine oculis-binding protein homolog
11	9606.ENSP00000253233	0.612	Probable peptide chain release factor C12orf65, mitochondrial
12	9606.ENSP00000317579	0.607	RUS1 family protein C16orf58
13	9606.ENSP00000193322	0.598	Osteopetrosis-associated transmembrane protein 1
14	9606.ENSP00000285083	0.594	Oxidoreductase NAD-binding domain-containing protein 1
15	9606.ENSP00000258214	0.557	Coiled-coil domain containing 102A
16	9606.ENSP00000313050	0.545	Protein NipSnap homolog 2
17	9606.ENSP00000481559	0.543	rRNA methyltransferase 1, mitochondrial
18	9606.ENSP00000462963	0.541	Transcription elongation factor, mitochondrial
19	9606.ENSP00000333551	0.539	Pyridoxal phosphate homeostasis protein
20	9606.ENSP00000240691	0.537	Taste receptor type 2 member 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043023	1.000	ribosomal large subunit binding
GO:0000049	1.000	tRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0044238	0.991	primary metabolic process
GO:0071704	0.990	organic substance metabolic process
GO:0044237	0.975	cellular metabolic process
GO:0006807	0.964	nitrogen compound metabolic process
GO:0043170	0.937	macromolecule metabolic process
GO:0065007	0.934	biological regulation
GO:0019538	0.924	protein metabolic process
GO:0050794	0.915	regulation of cellular process
GO:0010467	0.911	gene expression
GO:0044260	0.908	cellular macromolecule metabolic process
GO:0034641	0.907	cellular nitrogen compound metabolic process
GO:0006518	0.906	peptide metabolic process
GO:0031323	0.899	regulation of cellular metabolic process
GO:0010468	0.888	regulation of gene expression
GO:0062125	0.880	regulation of mitochondrial gene expression
GO:0044271	0.868	cellular nitrogen compound biosynthetic process
GO:0009059	0.854	macromolecule biosynthetic process
GO:0031326	0.852	regulation of cellular biosynthetic process
GO:0010556	0.844	regulation of macromolecule biosynthetic process
GO:0080090	0.841	regulation of primary metabolic process
GO:0051171	0.801	regulation of nitrogen compound metabolic process
GO:0006412	0.765	translation
GO:0006414	0.750	translational elongation
GO:0051252	0.659	regulation of RNA metabolic process
GO:0006355	0.649	regulation of DNA-templated transcription
GO:0071840	0.408	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.995	intracellular organelle lumen
GO:0005759	0.918	mitochondrial matrix
GO:0016020	0.465	membrane
GO:0031981	0.322	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]