StarFunc result for job id Q9P0R6

User Input

>input (139 residues)
METDCNPMELSSMSGFEEGSELNGFEGTDMKDMRLEAEAVVNDVLFAVNNMFVSKSLRCA
DDVAYINVETKERNRYCLELTEAGLKVVGYAFDQVDDHLQTPYHETVYSLLDTLSPAYRE
AFGNALLQRLEALKRDGQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5PPI3	0.821	0.821	1.464E-24	139	0.957	0.957	Q5PPI3.pdb.gz	GSKIP_RAT GSK3B-interacting protein OS=Rattus norvegicus OX=10116 GN=Gskip PE=1 SV=1
2	PDB:1sgoA	0.770	0.770	4.804E-22	139	1.000	1.000	1sgoA.pdb.gz
3	AFDB:Q22757	0.729	0.652	1.341E-11	156	0.302	0.269	Q22757.pdb.gz	Q22757_CAEEL GSKIP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T24H7.3 PE=1 SV=1
4	AFDB:Q9XWX6	0.744	0.435	1.230E-10	244	0.331	0.189	Q9XWX6.pdb.gz	Q9XWX6_CAEEL GSKIP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y43F8B.2 PE=1 SV=1
5	AFDB:Q9XWX7	0.707	0.318	7.626E-10	317	0.338	0.148	Q9XWX7.pdb.gz	Q9XWX7_CAEEL GSKIP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y43F8B.2 PE=1 SV=1
6	AFDB:O74973	0.604	0.751	3.974E-4	110	0.137	0.173	O74973.pdb.gz	YOKC_SCHPO Uncharacterized protein C4B4.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4B4.12c PE=4 SV=1
7	AFDB:B2RY50	0.512	0.085	1.127E-3	1037	0.101	0.014	B2RY50.pdb.gz	ODAD2_MOUSE Outer dynein arm-docking complex subunit 2 OS=Mus musculus OX=10090 GN=Odad2 PE=1 SV=1
8	AFDB:O15818	0.509	0.061	2.807E-3	1320	0.137	0.014	O15818.pdb.gz	CLU_DICDI Clustered mitochondria protein homolog OS=Dictyostelium discoideum OX=44689 GN=clua PE=1 SV=2
9	AFDB:F4HZK4	0.490	0.049	4.150E-3	1608	0.108	0.009	F4HZK4.pdb.gz	REC3_ARATH Protein REDUCED CHLOROPLAST COVERAGE 3 OS=Arabidopsis thaliana OX=3702 GN=REC3 PE=3 SV=1
10	AFDB:F4J5S1	0.520	0.057	6.136E-3	1407	0.151	0.015	F4J5S1.pdb.gz	CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana OX=3702 GN=FMT PE=2 SV=1
11	AFDB:A1ZAB5	0.529	0.056	1.528E-2	1448	0.122	0.012	A1ZAB5.pdb.gz	CLU_DROME Protein clueless OS=Drosophila melanogaster OX=7227 GN=clu PE=1 SV=1
12	PDB:2nvuC	0.258	0.214	8.266E-2	176	0.079	0.062	2nvuC.pdb.gz	Basis for a ubiquitin-like protein thioester switch toggling E1-E2 affinity.
13	PDB:6zhtB	0.297	0.280	1.005E-1	153	0.108	0.098	6zhtB.pdb.gz
14	PDB:3bzhA	0.251	0.227	1.693E-1	161	0.043	0.037	3bzhA.pdb.gz
15	PDB:7meyB	0.306	0.285	3.467E-1	153	0.094	0.085	7meyB.pdb.gz	Structural insights into Ubr1-mediated N-degron polyubiquitination.
16	PDB:1iznA	0.181	0.117	3.700E-1	275	0.180	0.091	1iznA.pdb.gz
17	PDB:2hlwA	0.233	0.202	3.700E-1	170	0.108	0.088	2hlwA.pdb.gz
18	PDB:4fhmA	0.225	0.097	3.949E-1	354	0.094	0.037	4fhmA.pdb.gz
19	PDB:1ifvA	0.231	0.215	5.126E-1	155	0.058	0.052	1ifvA.pdb.gz
20	PDB:4isyC	0.193	0.084	5.126E-1	383	0.050	0.018	4isyC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P0R6	2.19e-101	288	139	1.000	1.000	GSKIP_HUMAN GSK3B-interacting protein OS=Homo sapiens OX=9606 GN=GSKIP PE=1 SV=2
2	Q5PPI3	5.76e-97	276	139	0.957	0.957	GSKIP_RAT GSK3B-interacting protein OS=Rattus norvegicus OX=10116 GN=Gskip PE=1 SV=1
3	B1V8J2	1.58e-17	77.0	210	0.338	0.224	B1V8J2_CAEEL GSKIP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y43F8B.2 PE=1 SV=1
4	Q9XWX6	2.72e-17	77.0	244	0.345	0.197	Q9XWX6_CAEEL GSKIP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y43F8B.2 PE=1 SV=1
5	D9PTN9	6.76e-17	77.0	296	0.338	0.159	D9PTN9_CAEEL GSKIP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y43F8B.2 PE=1 SV=1
6	Q9XWX7	8.58e-17	77.0	317	0.338	0.148	Q9XWX7_CAEEL GSKIP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y43F8B.2 PE=1 SV=1
7	D9PTP0	1.27e-16	74.3	187	0.331	0.246	D9PTP0_CAEEL GSKIP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y43F8B.2 PE=1 SV=1
8	Q22757	2.85e-15	70.1	156	0.295	0.263	Q22757_CAEEL GSKIP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T24H7.3 PE=1 SV=1
9	D9PTP1	1.69e-10	57.4	139	0.223	0.223	D9PTP1_CAEEL GSKIP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y43F8B.2 PE=1 SV=1
10	P49960	2.0	30.4	444	0.108	0.034	PRP24_YEAST U4/U6 snRNA-associated-splicing factor PRP24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP24 PE=1 SV=1
11	Q008X5	4.3	29.6	4555	0.108	0.003	R1A_WBV24 Replicase polyprotein 1a OS=White bream virus (isolate Blicca bjoerkna L./Germany/DF24/00) OX=766180 GN=1a PE=1 SV=1
12	Q008X6	4.5	29.6	6872	0.108	0.002	R1AB_WBV24 Replicase polyprotein 1ab OS=White bream virus (isolate Blicca bjoerkna L./Germany/DF24/00) OX=766180 GN=rep PE=1 SV=1
13	P09405	8.5	28.5	707	0.180	0.035	NUCL_MOUSE Nucleolin OS=Mus musculus OX=10090 GN=Ncl PE=1 SV=2
14	O61643	9.9	28.5	946	0.245	0.036	INHB_DROME Inhibin beta chain OS=Drosophila melanogaster OX=7227 GN=Actbeta PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05303 GSKIP_dom	1.4e-29	113.6	GSKIP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000000680

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000012897	0.781	annotation not available
2	61853.ENSNLEP00000006160	0.670	Glycogen synthase kinase 3 beta
3	61853.ENSNLEP00000000672	0.610	Autophagy related 2B
4	61853.ENSNLEP00000014657	0.519	NBR1, autophagy cargo receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0051018	0.946	protein kinase A binding
GO:0019899	0.922	enzyme binding
GO:0019901	0.914	protein kinase binding
GO:0004860	0.640	protein kinase inhibitor activity
GO:0034237	0.601	protein kinase A regulatory subunit binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065009	0.995	regulation of molecular function
GO:0051174	0.995	regulation of phosphorus metabolic process
GO:0051348	0.993	negative regulation of transferase activity
GO:0010563	0.992	negative regulation of phosphorus metabolic process
GO:0051716	0.991	cellular response to stimulus
GO:0031399	0.989	regulation of protein modification process
GO:0051172	0.987	negative regulation of nitrogen compound metabolic process
GO:0010605	0.986	negative regulation of macromolecule metabolic process
GO:0009966	0.985	regulation of signal transduction
GO:0035556	0.982	intracellular signal transduction
GO:0030111	0.981	regulation of Wnt signaling pathway
GO:0045936	0.977	negative regulation of phosphate metabolic process
GO:0031400	0.977	negative regulation of protein modification process
GO:0070887	0.969	cellular response to chemical stimulus
GO:0060828	0.966	regulation of canonical Wnt signaling pathway
GO:0048518	0.959	positive regulation of biological process
GO:0012501	0.952	programmed cell death
GO:0048522	0.947	positive regulation of cellular process
GO:0042325	0.925	regulation of phosphorylation
GO:0042326	0.922	negative regulation of phosphorylation
GO:0043549	0.910	regulation of kinase activity
GO:0001932	0.910	regulation of protein phosphorylation
GO:0001933	0.900	negative regulation of protein phosphorylation
GO:0033673	0.860	negative regulation of kinase activity
GO:0006915	0.858	apoptotic process
GO:0006950	0.798	response to stress
GO:0023056	0.551	positive regulation of signaling
GO:0010647	0.493	positive regulation of cell communication
GO:0033554	0.488	cellular response to stress
GO:0045859	0.480	regulation of protein kinase activity
GO:0009967	0.474	positive regulation of signal transduction
GO:0097190	0.469	apoptotic signaling pathway
GO:0006469	0.442	negative regulation of protein kinase activity
GO:0097193	0.436	intrinsic apoptotic signaling pathway
GO:0008152	0.419	metabolic process
GO:0044237	0.374	cellular metabolic process
GO:0034599	0.365	cellular response to oxidative stress
GO:0090263	0.327	positive regulation of canonical Wnt signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0032991	0.632	protein-containing complex
GO:0005829	0.542	cytosol
GO:0043232	0.505	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]