StarFunc result for job id Q9P0S3

User Input

>input (153 residues)
MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFFSVPVAWTLTNIIHNLGM
YVFLHAVKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYD
PTHFILNTASLLSVLIPKMPQLHGVRIFGINKY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q921I0	0.969	0.969	6.302E-22	153	0.987	0.987	Q921I0.pdb.gz	ORML1_MOUSE ORM1-like protein 1 OS=Mus musculus OX=10090 GN=Ormdl1 PE=2 SV=1
2	AFDB:Q53FV1	0.940	0.940	1.266E-19	153	0.830	0.830	Q53FV1.pdb.gz	ORML2_HUMAN ORM1-like protein 2 OS=Homo sapiens OX=9606 GN=ORMDL2 PE=1 SV=2
3	AFDB:A0A024R1W6	0.980	0.980	1.467E-19	153	0.843	0.843	A0A024R1W6.pdb.gz
4	PDB:7k0mD	0.927	0.927	5.099E-18	153	0.843	0.843	7k0mD.pdb.gz	Structural insights into the regulation of human serine palmitoyltransferase complexes.
5	AFDB:Q9VP04	0.931	0.925	1.932E-13	154	0.477	0.474	Q9VP04.pdb.gz	ORMDL_DROME ORM1-like protein OS=Drosophila melanogaster OX=7227 GN=ORMDL PE=2 SV=1
6	AFDB:O42901	0.845	0.699	1.088E-10	186	0.359	0.296	O42901.pdb.gz	YBA9_SCHPO Uncharacterized protein C119.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC119.09c PE=2 SV=3
7	AFDB:Q9C5I0	0.894	0.872	6.726E-9	157	0.399	0.389	Q9C5I0.pdb.gz	Q9C5I0_ARATH ORMDL family protein OS=Arabidopsis thaliana OX=3702 GN=ATORM1 PE=1 SV=1
8	AFDB:P53224	0.833	0.580	1.796E-8	222	0.301	0.207	P53224.pdb.gz	ORM1_YEAST Protein ORM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ORM1 PE=1 SV=1
9	AFDB:Q9FHY3	0.874	0.869	1.981E-8	154	0.386	0.383	Q9FHY3.pdb.gz	Q9FHY3_ARATH At5g42000 OS=Arabidopsis thaliana OX=3702 GN=ATORM2 PE=1 SV=1
10	AFDB:Q06144	0.801	0.575	5.863E-7	216	0.314	0.222	Q06144.pdb.gz	ORM2_YEAST Protein ORM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ORM2 PE=1 SV=1
11	AFDB:Q9SB37	0.298	0.246	8.520E-1	201	0.085	0.065	Q9SB37.pdb.gz	PMEI7_ARATH Pectinesterase inhibitor 7 OS=Arabidopsis thaliana OX=3702 GN=PMEI7 PE=1 SV=1
12	PDB:7jpvE	0.268	0.289	1.343	139	0.124	0.137	7jpvE.pdb.gz	Structural Basis of the Modulation of the Voltage-Gated Calcium Ion Channel Ca v 1.1 by Dihydropyridine Compounds*.
13	PDB:3egwC	0.151	0.124	2.306	225	0.144	0.098	3egwC.pdb.gz	When width is more important than height: Barriers to electron transfer in E.coli nitrate reductase
14	PDB:2fd5A	0.182	0.162	2.543	180	0.092	0.078	2fd5A.pdb.gz
15	PDB:5gm6Z	0.215	0.106	3.587	447	0.137	0.047	5gm6Z.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:6ov2A	0.261	0.235	4.156	182	0.065	0.055	6ov2A.pdb.gz
17	PDB:4xesA	0.288	0.134	4.365	471	0.092	0.030	4xesA.pdb.gz	Structural prerequisites for G-protein activation by the neurotensin receptor.
18	PDB:5mg3D	0.174	0.086	4.585	414	0.150	0.056	5mg3D.pdb.gz
19	PDB:6co7A	0.175	0.038	4.585	1061	0.105	0.015	6co7A.pdb.gz	Structure of a TRPM2 channel in complex with Ca2+explains unique gating regulation.
20	PDB:7kvjA	0.239	0.110	4.815	415	0.078	0.029	7kvjA.pdb.gz	Rational Design of CYP3A4 Inhibitors: A One-Atom Linker Elongation in Ritonavir-Like Compounds Leads to a Marked Improvement in the Binding Strength.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P0S3	4.06e-111	313	153	1.000	1.000	ORML1_HUMAN ORM1-like protein 1 OS=Homo sapiens OX=9606 GN=ORMDL1 PE=1 SV=1
2	Q921I0	8.50e-110	310	153	0.987	0.987	ORML1_MOUSE ORM1-like protein 1 OS=Mus musculus OX=10090 GN=Ormdl1 PE=2 SV=1
3	Q8N138	4.75e-98	280	153	0.843	0.843	ORML3_HUMAN ORM1-like protein 3 OS=Homo sapiens OX=9606 GN=ORMDL3 PE=1 SV=1
4	Q9CPZ6	5.30e-98	280	153	0.843	0.843	ORML3_MOUSE ORM1-like protein 3 OS=Mus musculus OX=10090 GN=Ormdl3 PE=2 SV=1
5	Q53FV1	5.81e-96	275	153	0.830	0.830	ORML2_HUMAN ORM1-like protein 2 OS=Homo sapiens OX=9606 GN=ORMDL2 PE=1 SV=2
6	J3QRM9	1.20e-80	236	129	0.699	0.829	J3QRM9_HUMAN ORMDL sphingolipid biosynthesis regulator 3 (Fragment) OS=Homo sapiens OX=9606 GN=ORMDL3 PE=1 SV=1
7	A0A1B0GXE7	9.44e-77	225	109	0.712	1.000	A0A1B0GXE7_HUMAN ORMDL sphingolipid biosynthesis regulator 1 OS=Homo sapiens OX=9606 GN=ORMDL1 PE=1 SV=1
8	F6WST4	3.34e-76	224	108	0.706	1.000	F6WST4_HUMAN ORMDL sphingolipid biosynthesis regulator 1 (Fragment) OS=Homo sapiens OX=9606 GN=ORMDL1 PE=1 SV=7
9	F8VXD5	1.10e-72	215	119	0.641	0.824	F8VXD5_HUMAN ORMDL sphingolipid biosynthesis regulator 2 OS=Homo sapiens OX=9606 GN=ORMDL2 PE=1 SV=1
10	Q9VP04	2.64e-48	154	154	0.477	0.474	ORMDL_DROME ORM1-like protein OS=Drosophila melanogaster OX=7227 GN=ORMDL PE=2 SV=1
11	O42901	2.75e-33	117	186	0.392	0.323	YBA9_SCHPO Uncharacterized protein C119.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC119.09c PE=2 SV=3
12	Q9C5I0	7.34e-30	108	157	0.392	0.382	Q9C5I0_ARATH ORMDL family protein OS=Arabidopsis thaliana OX=3702 GN=ATORM1 PE=1 SV=1
13	Q9FHY3	2.40e-29	106	154	0.386	0.383	Q9FHY3_ARATH At5g42000 OS=Arabidopsis thaliana OX=3702 GN=ATORM2 PE=1 SV=1
14	Q06144	4.15e-18	79.3	216	0.340	0.241	ORM2_YEAST Protein ORM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ORM2 PE=1 SV=1
15	P53224	1.01e-17	78.6	222	0.314	0.216	ORM1_YEAST Protein ORM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ORM1 PE=1 SV=1
16	F8W2M1	1.1	31.6	904	0.196	0.033	HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio OX=7955 GN=hace1 PE=3 SV=2
17	Q8IYU2	1.6	31.2	909	0.190	0.032	HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens OX=9606 GN=HACE1 PE=1 SV=2
18	A0N0Q1	5.5	29.3	360	0.144	0.061	A0N0Q1_HUMAN Chemokine (C-C motif) receptor 4 OS=Homo sapiens OX=9606 GN=CCR4 PE=2 SV=1
19	P51679	5.5	29.3	360	0.144	0.061	CCR4_HUMAN C-C chemokine receptor type 4 OS=Homo sapiens OX=9606 GN=CCR4 PE=1 SV=1
20	R4GER2	6.3	29.3	485	0.098	0.031	ATG4D_DANRE Cysteine protease atg4da OS=Danio rerio OX=7955 GN=atg4da PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04061 ORMDL	3.9e-49	177.4	ORMDL family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008591615.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008592166.1	0.962	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
2	482537.XP_008575446.1	0.912	Serine palmitoyltransferase small subunit A-like
3	482537.XP_008566577.1	0.911	Serine palmitoyltransferase small subunit B
4	482537.XP_008588493.1	0.817	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 13 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
5	482537.XP_008562961.1	0.793	Serine palmitoyltransferase 3
6	482537.XP_008577428.1	0.734	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 14 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
7	482537.XP_008580235.1	0.715	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
8	482537.XP_008574842.1	0.688	nogo-B receptor
9	482537.XP_008566981.1	0.687	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
10	482537.XP_008584397.1	0.669	Golgin subfamily A member 7B
11	482537.XP_008566635.1	0.634	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 13 Proteins, and 80% coverage of the annotated genomic feature by RNAseq alignments
12	482537.XP_008577308.1	0.610	Vesicle transport protein SFT2B
13	482537.XP_008567978.1	0.572	2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial
14	482537.XP_008570793.1	0.572	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 21 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
15	482537.XP_008584051.1	0.572	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 15 Proteins, and 70% coverage of the annotated genomic feature by RNAseq alignments
16	482537.XP_008579908.1	0.558	PR domain zinc finger protein 12
17	482537.XP_008579263.1	0.556	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 14 Proteins, and 94% coverage of the annotated genomic feature by RNAseq alignments
18	482537.XP_008579113.1	0.550	Small membrane A-kinase anchor protein
19	482537.XP_008584995.1	0.550	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 93% coverage of the annotated genomic feature by RNAseq alignments
20	482537.XP_008590213.1	0.550	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0044238	0.992	primary metabolic process
GO:0044237	0.992	cellular metabolic process
GO:1901564	0.987	organonitrogen compound metabolic process
GO:0034248	0.985	regulation of amide metabolic process
GO:0019216	0.985	regulation of lipid metabolic process
GO:0044087	0.982	regulation of cellular component biogenesis
GO:0046890	0.982	regulation of lipid biosynthetic process
GO:0043603	0.969	amide metabolic process
GO:0006665	0.967	sphingolipid metabolic process
GO:0031323	0.959	regulation of cellular metabolic process
GO:0006672	0.948	ceramide metabolic process
GO:0060255	0.878	regulation of macromolecule metabolic process
GO:0031326	0.878	regulation of cellular biosynthetic process
GO:0010556	0.870	regulation of macromolecule biosynthetic process
GO:0045833	0.804	negative regulation of lipid metabolic process
GO:0051055	0.779	negative regulation of lipid biosynthetic process
GO:0034249	0.630	negative regulation of amide metabolic process
GO:0009058	0.618	biosynthetic process
GO:0048523	0.573	negative regulation of cellular process
GO:0031327	0.555	negative regulation of cellular biosynthetic process
GO:0044249	0.513	cellular biosynthetic process
GO:1901576	0.506	organic substance biosynthetic process
GO:1901566	0.460	organonitrogen compound biosynthetic process
GO:0046467	0.355	membrane lipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005783	0.991	endoplasmic reticulum
GO:0016020	0.976	membrane
GO:0031090	0.947	organelle membrane
GO:0005789	0.907	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]