StarFunc result for job id Q9P0U1

User Input

>input (55 residues)
MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q75MR5	0.832	0.832	2.946E-8	55	1.000	1.000	Q75MR5.pdb.gz	Q75MR5_HUMAN Mitochondrial import receptor subunit TOM7 homolog OS=Homo sapiens OX=9606 GN=TOM7 PE=1 SV=1
2	PDB:7vc4G	0.761	0.761	9.723E-8	55	1.000	1.000	7vc4G.pdb.gz
3	AFDB:P53507	0.618	0.573	1.003E-1	60	0.291	0.267	P53507.pdb.gz	TOM7_YEAST Mitochondrial import receptor subunit TOM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOM7 PE=1 SV=2
4	PDB:6ucuE	0.574	0.616	3.838E-1	50	0.255	0.280	6ucuE.pdb.gz
5	AFDB:O74700	0.552	0.388	5.789	87	0.145	0.092	O74700.pdb.gz	TIM9_YEAST Mitochondrial import inner membrane translocase subunit TIM9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM9 PE=1 SV=1
6	AFDB:Q24342	0.387	0.076	5.789	412	0.164	0.022	Q24342.pdb.gz	FNG_DROME Fringe glycosyltransferase OS=Drosophila melanogaster OX=7227 GN=fng PE=1 SV=1
7	AFDB:Q47150	0.322	0.216	7.222	86	0.109	0.070	Q47150.pdb.gz	DINJ_ECOLI Antitoxin DinJ OS=Escherichia coli (strain K12) OX=83333 GN=dinJ PE=1 SV=1
8	PDB:6lo8E	0.460	0.359	7.326	80	0.164	0.113	6lo8E.pdb.gz
9	AFDB:B2ZFP3	0.350	0.035	8.369	807	0.200	0.014	B2ZFP3.pdb.gz	SMAL1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio OX=7955 GN=smarcal1 PE=2 SV=1
10	PDB:7pzyE	0.333	0.092	8.490	223	0.127	0.031	7pzyE.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
11	PDB:7qski	0.373	0.176	8.490	127	0.236	0.102	7qski.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
12	AFDB:Q12510	0.388	0.049	9.010	522	0.164	0.017	Q12510.pdb.gz	CMR1_YEAST DNA damage-binding protein CMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CMR1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q75MR5	3.07e-34	112	55	1.000	1.000	Q75MR5_HUMAN Mitochondrial import receptor subunit TOM7 homolog OS=Homo sapiens OX=9606 GN=TOM7 PE=1 SV=1
2	Q9P0U1	3.07e-34	112	55	1.000	1.000	TOM7_HUMAN Mitochondrial import receptor subunit TOM7 homolog OS=Homo sapiens OX=9606 GN=TOMM7 PE=1 SV=1
3	Q9D173	2.93e-32	107	55	0.945	0.945	TOM7_MOUSE Mitochondrial import receptor subunit TOM7 homolog OS=Mus musculus OX=10090 GN=Tomm7 PE=3 SV=1
4	P34660	3.91e-11	53.5	58	0.527	0.500	TOM7_CAEEL Mitochondrial import receptor subunit TOM7 homolog OS=Caenorhabditis elegans OX=6239 GN=tomm-7 PE=3 SV=1
5	O42999	0.001	34.7	52	0.255	0.269	TOM7_SCHPO Mitochondrial import receptor subunit tom7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tom7 PE=3 SV=2
6	P53507	0.001	34.7	60	0.291	0.267	TOM7_YEAST Mitochondrial import receptor subunit TOM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOM7 PE=1 SV=2
7	Q9CAT3	1.1	28.1	513	0.291	0.031	Q9CAT3_ARATH Eukaryotic translation initiation factor 2A OS=Arabidopsis thaliana OX=3702 GN=At1g73180 PE=1 SV=1
8	B2RW88	6.8	26.2	366	0.200	0.030	PRR19_MOUSE Proline-rich protein 19 OS=Mus musculus OX=10090 GN=Prr19 PE=1 SV=1
9	O59747	7.2	25.8	622	0.200	0.018	PDF1_SCHPO Palmitoyl-protein thioesterase-dolichyl pyrophosphate phosphatase fusion 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pdf1 PE=1 SV=2
10	Q54RZ5	8.4	25.0	55	0.164	0.164	Q54RZ5_DICDI Translocase of outer mitochondrial membrane OS=Dictyostelium discoideum OX=44689 GN=tom7 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08038 Tom7	8e-13	59.1	TOM7 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351214

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216034	0.999	Mitochondrial import receptor subunit TOM22 homolog
2	9606.ENSP00000381859	0.999	Mitochondrial import receptor subunit TOM6 homolog
3	9606.ENSP00000410339	0.999	Mitochondrial import receptor subunit TOM40 homolog
4	9606.ENSP00000355566	0.998	Mitochondrial import receptor subunit TOM20 homolog
5	9606.ENSP00000438204	0.996	Mitochondrial import receptor subunit TOM5 homolog
6	9606.ENSP00000284320	0.995	Mitochondrial import receptor subunit TOM70
7	9606.ENSP00000320236	0.974	Mitochondrial import inner membrane translocase subunit Tim22
8	9606.ENSP00000364204	0.958	Serine/threonine-protein kinase PINK1, mitochondrial
9	9606.ENSP00000297185	0.951	Stress-70 protein, mitochondrial
10	9606.ENSP00000345445	0.945	Sorting and assembly machinery component 50 homolog
11	9606.ENSP00000445806	0.928	Mitochondrial import inner membrane translocase subunit TIM50
12	9606.ENSP00000357360	0.920	Metaxin-1
13	9606.ENSP00000216254	0.917	Aconitate hydratase, mitochondrial
14	9606.ENSP00000378588	0.914	Mitochondrial import inner membrane translocase subunit Tim9
15	9606.ENSP00000262030	0.912	ATP synthase subunit beta, mitochondrial
16	9606.ENSP00000377033	0.912	ATP synthase F(0) complex subunit C1, mitochondrial
17	9606.ENSP00000381736	0.912	ATP synthase subunit alpha, mitochondrial
18	9606.ENSP00000317159	0.910	Cytochrome c1, heme protein, mitochondrial
19	9606.ENSP00000356967	0.909	Mitochondrial import receptor subunit TOM40B
20	9606.ENSP00000413908	0.909	Mitochondrial chaperone BCS1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008320	0.846	protein transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0006626	0.976	protein targeting to mitochondrion
GO:0050794	0.946	regulation of cellular process
GO:1903747	0.884	regulation of establishment of protein localization to mitochondrion
GO:0033157	0.877	regulation of intracellular protein transport
GO:0048522	0.837	positive regulation of cellular process
GO:0050896	0.835	response to stimulus
GO:1903533	0.801	regulation of protein targeting
GO:0051716	0.750	cellular response to stimulus
GO:0031647	0.750	regulation of protein stability
GO:0090316	0.750	positive regulation of intracellular protein transport
GO:0006950	0.678	response to stress
GO:0033554	0.647	cellular response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0031090	0.998	organelle membrane
GO:0031967	0.998	organelle envelope
GO:0032991	0.997	protein-containing complex
GO:0031966	0.988	mitochondrial membrane
GO:0098588	0.986	bounding membrane of organelle
GO:0098798	0.977	mitochondrial protein-containing complex
GO:0031968	0.975	organelle outer membrane
GO:0098796	0.974	membrane protein complex
GO:0005741	0.920	mitochondrial outer membrane
GO:0005742	0.817	mitochondrial outer membrane translocase complex
GO:0070013	0.533	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]