StarFunc result for job id Q9P0U3

User Input

>input (644 residues)
MDDIADRMRMDAGEVTLVNHNSVFKTHLLPQTGFPEDQLSLSDQQILSSRQGHLDRSFTC
STRSAAYNPSYYSDNPSSDSFLGSGDLRTFGQSANGQWRNSTPSSSSSLQKSRNSRSLYL
ETRKTSSGLSNSFAGKSNHHCHVSAYEKSFPIKPVPSPSWSGSCRRSLLSPKKTQRRHVS
TAEETVQEEEREIYRQLLQMVTGKQFTIAKPTTHFPLHLSRCLSSSKNTLKDSLFKNGNS
CASQIIGSDTSSSGSASILTNQEQLSHSVYSLSSYTPDVAFGSKDSGTLHHPHHHHSVPH
QPDNLAASNTQSEGSDSVILLKVKDSQTPTPSSTFFQAELWIKELTSVYDSRARERLRQI
EEQKALALQLQNQRLQEREHSVHDSVELHLRVPLEKEIPVTVVQETQKKGHKLTDSEDEF
PEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLME
RSKEKGLPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVD
FRKKNITYYDSMGGINNEACRILLQYLKQESIDKKRKEFDTNGWQLFSKKSQEIPQQMNG
SDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P0U3	1.000	1.000	2.376E-94	644	1.000	1.000	Q9P0U3.pdb.gz	SENP1_HUMAN Sentrin-specific protease 1 OS=Homo sapiens OX=9606 GN=SENP1 PE=1 SV=2
2	AFDB:P59110	0.514	0.517	1.912E-81	640	0.884	0.889	P59110.pdb.gz	SENP1_MOUSE Sentrin-specific protease 1 OS=Mus musculus OX=10090 GN=Senp1 PE=1 SV=1
3	AFDB:Q5B9U1	0.312	0.210	8.471E-16	965	0.194	0.130	Q5B9U1.pdb.gz	Q5B9U1_EMENI Nuclear pore complex subunit Nup133, putative (AFU_orthologue AFUA_5G14040) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02689 PE=3 SV=1
4	PDB:2bkrA	0.261	0.732	6.854E-10	211	0.064	0.194	2bkrA.pdb.gz
5	AFDB:Q9GZR1	0.279	0.167	3.347E-5	1112	0.185	0.107	Q9GZR1.pdb.gz	SENP6_HUMAN Sentrin-specific protease 6 OS=Homo sapiens OX=9606 GN=SENP6 PE=1 SV=2
6	PDB:5hafB	0.201	0.361	1.288E-4	327	0.033	0.064	5hafB.pdb.gz
7	PDB:5io3A	0.173	0.256	1.080E-3	385	0.051	0.086	5io3A.pdb.gz
8	PDB:1avpA	0.115	0.275	5.475E-3	204	0.036	0.113	1avpA.pdb.gz	Crystal structure of the human adenovirus proteinase with its 11 amino acid cofactor.
9	AFDB:F4IS91	0.082	0.051	1.669E-2	1340	0.148	0.071	F4IS91.pdb.gz	RSA1_ARATH Protein SHORT ROOT IN SALT MEDIUM 1 OS=Arabidopsis thaliana OX=3702 GN=RSA1 PE=1 SV=1
10	AFDB:Q3LHL9	0.091	0.040	2.898E-1	1658	0.104	0.040	Q3LHL9.pdb.gz	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
11	AFDB:A0A024R5T1	0.073	0.069	3.624E-1	682	0.143	0.135	A0A024R5T1.pdb.gz
12	AFDB:Q4G5U8	0.069	0.059	4.795E-1	780	0.120	0.099	Q4G5U8.pdb.gz
13	AFDB:A5PLH2	0.093	0.118	5.363E-1	480	0.118	0.158	A5PLH2.pdb.gz
14	AFDB:F7BGG6	0.095	0.089	5.363E-1	702	0.113	0.104	F7BGG6.pdb.gz	F7BGG6_XENTR Transcription factor 12 (HTF4, helix-loop-helix transcription factors 4) OS=Xenopus tropicalis OX=8364 GN=tcf12 PE=4 SV=4
15	PDB:4hl2A	0.056	0.127	1.054	243	0.008	0.021	4hl2A.pdb.gz	New Delhi Metallo-beta-Lactamase-1 1.05 A structure Complexed with Hydrolyzed Ampicillin
16	PDB:3thwA	0.051	0.042	1.115	890	0.026	0.019	3thwA.pdb.gz	Mechanism of mismatch recognition revealed by human MutSbeta bound to unpaired DNA loops
17	PDB:1n3gA	0.066	0.254	1.650	113	0.014	0.080	1n3gA.pdb.gz
18	PDB:2q0jA	0.060	0.104	1.745	310	0.036	0.074	2q0jA.pdb.gz	Structure elucidation and preliminary assessment of hydrolase activity of PqsE, the Pseudomonas quinolone signal (PQS) response protein.
19	PDB:1m2vA	0.063	0.060	1.845	705	0.020	0.018	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
20	PDB:1uwcA	0.067	0.143	1.952	261	0.016	0.038	1uwcA.pdb.gz	Structure of a Feruloyl Esterase from Aspergillus Niger

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59110	0.0	1129	640	0.884	0.889	SENP1_MOUSE Sentrin-specific protease 1 OS=Mus musculus OX=10090 GN=Senp1 PE=1 SV=1
2	Q9P0U3	0.0	1345	644	1.000	1.000	SENP1_HUMAN Sentrin-specific protease 1 OS=Homo sapiens OX=9606 GN=SENP1 PE=1 SV=2
3	Q9HC62	2.78e-95	306	589	0.225	0.246	SENP2_HUMAN Sentrin-specific protease 2 OS=Homo sapiens OX=9606 GN=SENP2 PE=1 SV=3
4	Q91ZX6	1.41e-94	305	588	0.227	0.248	SENP2_MOUSE Sentrin-specific protease 2 OS=Mus musculus OX=10090 GN=Senp2 PE=1 SV=2
5	Q9EQE1	1.10e-93	302	588	0.213	0.233	SENP2_RAT Sentrin-specific protease 2 OS=Rattus norvegicus OX=10116 GN=Senp2 PE=1 SV=1
6	Q6IE23	6.65e-89	286	475	0.189	0.257	Q6IE23_RAT Sentrin/SUMO-specific protease 17 OS=Rattus norvegicus OX=10116 GN=Senp17 PE=2 SV=1
7	Q09353	5.25e-67	234	697	0.155	0.143	SENP_CAEEL Sentrin-specific protease OS=Caenorhabditis elegans OX=6239 GN=ulp-1 PE=2 SV=3
8	Q7KMN4	1.01e-60	216	674	0.157	0.150	Q7KMN4_DROME BcDNA.GH02751 OS=Drosophila melanogaster OX=7227 GN=Ulp1 PE=2 SV=1
9	Q9VWK5	1.26e-59	219	1513	0.157	0.067	Q9VWK5_DROME GH15225p OS=Drosophila melanogaster OX=7227 GN=Ulp1 PE=1 SV=1
10	O42957	8.40e-52	190	568	0.140	0.158	ULP1_SCHPO Ubiquitin-like-specific protease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ulp1 PE=3 SV=1
11	Q9EP97	7.68e-46	173	568	0.129	0.146	SENP3_MOUSE Sentrin-specific protease 3 OS=Mus musculus OX=10090 GN=Senp3 PE=1 SV=1
12	Q9H4L4	9.45e-46	173	574	0.129	0.145	SENP3_HUMAN Sentrin-specific protease 3 OS=Homo sapiens OX=9606 GN=SENP3 PE=1 SV=2
13	A0A1D8PSK4	4.03e-45	169	491	0.137	0.179	A0A1D8PSK4_CANAL SUMO protease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ULP2 PE=3 SV=1
14	Q94F30	1.29e-44	168	489	0.141	0.186	ESD4_ARATH Ubiquitin-like-specific protease ESD4 OS=Arabidopsis thaliana OX=3702 GN=ESD4 PE=1 SV=1
15	Q96HI0	1.58e-41	163	755	0.130	0.111	SENP5_HUMAN Sentrin-specific protease 5 OS=Homo sapiens OX=9606 GN=SENP5 PE=1 SV=3
16	Q8GYL3	1.98e-37	148	502	0.140	0.179	ULP1A_ARATH Ubiquitin-like-specific protease 1A OS=Arabidopsis thaliana OX=3702 GN=ULP1A PE=2 SV=2
17	Q5B9U1	5.60e-32	134	965	0.112	0.075	Q5B9U1_EMENI Nuclear pore complex subunit Nup133, putative (AFU_orthologue AFUA_5G14040) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02689 PE=3 SV=1
18	J3QL36	1.23e-29	119	237	0.102	0.278	J3QL36_HUMAN SUMO specific peptidase 3 (Fragment) OS=Homo sapiens OX=9606 GN=SENP3 PE=1 SV=1
19	Q02724	9.56e-26	114	621	0.112	0.116	ULP1_YEAST Ubiquitin-like-specific protease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULP1 PE=1 SV=1
20	O13769	5.91e-18	90.1	638	0.090	0.091	ULP2_SCHPO Ubiquitin-like-specific protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ulp2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02902 Peptidase_C48	2.3e-44	163.4	Ulp1 protease family, C-terminal catalytic domain
2	PF03290 Peptidase_C57	34	14.6	Vaccinia virus I7 processing peptidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000394791

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376077	0.999	Small ubiquitin-related modifier 1
2	9606.ENSP00000405965	0.999	Small ubiquitin-related modifier 2
3	9606.ENSP00000409666	0.997	Small ubiquitin-like modifier 3
4	9606.ENSP00000401470	0.994	Ran GTPase-activating protein 1
5	9606.ENSP00000261574	0.956	Importin-5
6	9606.ENSP00000362649	0.956	Histone deacetylase 1
7	9606.ENSP00000318635	0.942	Small ubiquitin-related modifier 4
8	9606.ENSP00000348056	0.940	SUMO-conjugating enzyme UBC9
9	9606.ENSP00000212015	0.935	NAD-dependent protein deacetylase sirtuin-1
10	9606.ENSP00000270225	0.898	SUMO-activating enzyme subunit 1
11	9606.ENSP00000246548	0.875	SUMO-activating enzyme subunit 2
12	9606.ENSP00000290158	0.873	Importin subunit beta-1
13	9606.ENSP00000402527	0.865	Sentrin-specific protease 6
14	9606.ENSP00000262971	0.833	E3 SUMO-protein ligase PIAS4
15	9606.ENSP00000376765	0.824	E3 SUMO-protein ligase PIAS3
16	9606.ENSP00000261667	0.813	Importin subunit alpha-4
17	9606.ENSP00000249636	0.808	E3 SUMO-protein ligase PIAS1
18	9606.ENSP00000465676	0.806	E3 SUMO-protein ligase PIAS2
19	9606.ENSP00000300087	0.788	Dynactin subunit 5
20	9606.ENSP00000444029	0.770	Nuclear pore complex protein Nup153

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019783	1.000	ubiquitin-like protein peptidase activity
GO:0004197	0.997	cysteine-type endopeptidase activity
GO:0070139	0.827	SUMO-specific endopeptidase activity
GO:0016929	0.390	deSUMOylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0044238	0.997	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0070647	0.994	protein modification by small protein conjugation or removal
GO:0019222	0.993	regulation of metabolic process
GO:0006508	0.991	proteolysis
GO:0009987	0.987	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0051171	0.984	regulation of nitrogen compound metabolic process
GO:0070646	0.979	protein modification by small protein removal
GO:0018193	0.976	peptidyl-amino acid modification
GO:0080090	0.973	regulation of primary metabolic process
GO:0018205	0.973	peptidyl-lysine modification
GO:0060255	0.971	regulation of macromolecule metabolic process
GO:0031323	0.970	regulation of cellular metabolic process
GO:0048518	0.935	positive regulation of biological process
GO:0051246	0.920	regulation of protein metabolic process
GO:0010604	0.867	positive regulation of macromolecule metabolic process
GO:0051173	0.866	positive regulation of nitrogen compound metabolic process
GO:0019219	0.840	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.819	regulation of gene expression
GO:0032446	0.813	protein modification by small protein conjugation
GO:0048522	0.805	positive regulation of cellular process
GO:0010556	0.785	regulation of macromolecule biosynthetic process
GO:0031326	0.779	regulation of cellular biosynthetic process
GO:0030162	0.777	regulation of proteolysis
GO:0051252	0.776	regulation of RNA metabolic process
GO:0031325	0.772	positive regulation of cellular metabolic process
GO:0051716	0.755	cellular response to stimulus
GO:2001141	0.746	regulation of RNA biosynthetic process
GO:0006355	0.733	regulation of DNA-templated transcription
GO:0065009	0.722	regulation of molecular function
GO:0045935	0.637	positive regulation of nucleobase-containing compound metabolic process
GO:0051247	0.572	positive regulation of protein metabolic process
GO:0016925	0.490	protein sumoylation
GO:0007165	0.409	signal transduction
GO:0048519	0.408	negative regulation of biological process
GO:0044237	0.382	cellular metabolic process
GO:0051254	0.339	positive regulation of RNA metabolic process
GO:0009892	0.323	negative regulation of metabolic process
GO:1902680	0.320	positive regulation of RNA biosynthetic process
GO:0006357	0.316	regulation of transcription by RNA polymerase II
GO:0044093	0.313	positive regulation of molecular function
GO:0010605	0.307	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005635	0.998	nuclear envelope
GO:0016020	0.997	membrane
GO:0031090	0.986	organelle membrane
GO:0005737	0.955	cytoplasm
GO:0005829	0.947	cytosol
GO:0032991	0.916	protein-containing complex
GO:0031965	0.873	nuclear membrane
GO:0030054	0.864	cell junction
GO:0070161	0.777	anchoring junction
GO:0030055	0.748	cell-substrate junction
GO:0005925	0.644	focal adhesion
GO:0140513	0.375	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	0.997	Cysteine endopeptidases.

[back to server]