StarFunc result for job id Q9P0V3

User Input

>input (963 residues)
MAAQRIRAANSNGLPRCKSEGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEV
IAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLS
DSGMIDNLPDSPDEVAKELELLGGWTDDKKVPGRMYSNNPFWNGVQTNPFLNGNVPVMPS
LDELNPKSTVDLLLFDAGTSSFTESSSATTNSTGNIFDELPVTNGLHAEPPVRRDNPFFR
SKRSYSLSELSVLQAKSDAPTSSSFFTGLKSPAPEQFQSREDFRTAWLNHRKLARSCHDL
DLLGQSPGWGQTQAVETNIVCKLDSSGGAVQLPDTSISIHVPEGHVAPGETQQISMKALL
DPPLELNSDRSCSISPVLEVKLSNLEVKTSIILEMKVSAEIKNDLFSKSTVGLQCLRSDS
KEGPYVSVPLNCSCGDTVQAQLHNLEPCMYVAVVAHGPSILYPSTVWDFINKKVTVGLYG
PKHIHPSFKTVVTIFGHDCAPKTLLVSEVTRQAPNPAPVALQLWGKHQFVLSRPQDLKVC
MFSNMTNYEVKASEQAKVVRGFQLKLGKVSRLIFPITSQNPNELSDFTLRVQVKDDQEAI
LTQFCVQTPQPPPKSAIKPSGQRRFLKKNEVGKIILSPFATTTKYPTFQDRPVSSLKFGK
LLKTVVRQNKNHYLLEYKKGDGIALLSEERVRLRGQLWTKEWYIGYYQGRVGLVHTKNVL
VVGRARPSLCSGPELSTSVLLEQILRPCKFLTYIYASVRTLLMENISSWRSFADALGYVN
LPLTFFCRAELDSEPERVASVLEKLKEDCNNTENKERKSFQKELVMALLKMDCQGLVVRL
IQDFVLLTTAVEVAQRWRELAEKLAKVSKQQMDAYESPHRDRNGVVDSEAMWKPAYDFLL
TWSHQIGDSYRDVIQELHLGLDKMKNPITKRWKHLTGTLILVNSLDVLRAAAFSPADQDD
FVI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P0V3	1.000	1.000	0.000	963	1.000	1.000	Q9P0V3.pdb.gz	SH3B4_HUMAN SH3 domain-binding protein 4 OS=Homo sapiens OX=9606 GN=SH3BP4 PE=1 SV=1
2	AFDB:A0A2R8PZH9	0.472	0.520	4.377E-80	858	0.347	0.389	A0A2R8PZH9.pdb.gz
3	AFDB:Q6ZN28	0.457	0.505	1.443E-78	852	0.363	0.411	Q6ZN28.pdb.gz	MACC1_HUMAN Metastasis-associated in colon cancer protein 1 OS=Homo sapiens OX=9606 GN=MACC1 PE=1 SV=2
4	AFDB:O43059	0.077	0.088	3.945E-7	818	0.083	0.098	O43059.pdb.gz	SYP1_SCHPO Cytoskeletal protein syp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=syp1 PE=1 SV=1
5	AFDB:Q1LYG0	0.074	0.065	4.353E-7	1119	0.094	0.081	Q1LYG0.pdb.gz	SPD2A_DANRE SH3 and PX domain-containing protein 2A OS=Danio rerio OX=7955 GN=sh3pxd2a PE=3 SV=2
6	AFDB:Q8TEP8	0.078	0.035	7.482E-7	2537	0.097	0.037	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3
7	PDB:7crwA	0.182	0.517	8.386E-7	279	0.035	0.122	7crwA.pdb.gz
8	AFDB:F1M3L7	0.068	0.079	2.562E-6	822	0.051	0.060	F1M3L7.pdb.gz	EPS8_RAT Epidermal growth factor receptor kinase substrate 8 OS=Rattus norvegicus OX=10116 GN=Eps8 PE=1 SV=2
9	AFDB:E7EQN5	0.064	0.067	2.827E-6	925	0.036	0.038	E7EQN5.pdb.gz	E7EQN5_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
10	AFDB:E9PCM6	0.066	0.082	5.632E-6	768	0.038	0.048	E9PCM6.pdb.gz	E9PCM6_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
11	AFDB:A0A0G2JVF0	0.061	0.062	9.215E-6	955	0.037	0.038	A0A0G2JVF0.pdb.gz	A0A0G2JVF0_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=1 SV=2
12	PDB:7jkqB	0.188	0.545	2.796E-4	272	0.036	0.129	7jkqB.pdb.gz
13	PDB:3ehqA	0.060	0.306	1.225E-3	182	0.018	0.093	3ehqA.pdb.gz
14	PDB:1k9aB	0.058	0.126	1.908E-3	441	0.021	0.045	1k9aB.pdb.gz
15	PDB:2lqnA	0.068	0.198	1.908E-3	303	0.025	0.079	2lqnA.pdb.gz
16	PDB:6xt9I	0.070	0.086	2.004E-3	767	0.088	0.111	6xt9I.pdb.gz
17	PDB:2h8hA	0.056	0.121	2.105E-3	445	0.024	0.052	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
18	PDB:1griA	0.062	0.277	2.323E-3	211	0.020	0.090	1griA.pdb.gz
19	PDB:3qwyA	0.059	0.322	2.693E-3	170	0.021	0.118	3qwyA.pdb.gz
20	PDB:2dybA	0.058	0.185	4.861E-3	298	0.015	0.047	2dybA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7FG38	0.0	637	853	0.367	0.414	E7FG38_DANRE MET transcriptional regulator MACC1 OS=Danio rerio OX=7955 GN=macc1 PE=4 SV=1
2	Q6ZN28	0.0	652	852	0.375	0.424	MACC1_HUMAN Metastasis-associated in colon cancer protein 1 OS=Homo sapiens OX=9606 GN=MACC1 PE=1 SV=2
3	Q9P0V3	0.0	1995	963	1.000	1.000	SH3B4_HUMAN SH3 domain-binding protein 4 OS=Homo sapiens OX=9606 GN=SH3BP4 PE=1 SV=1
4	A1A5H8	1.12e-06	54.7	546	0.030	0.053	YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio OX=7955 GN=yes1 PE=1 SV=1
5	Q9V9J3	3.60e-06	53.1	517	0.029	0.054	SRC42_DROME Tyrosine-protein kinase Src42A OS=Drosophila melanogaster OX=7227 GN=Src42A PE=1 SV=1
6	P12931	3.65e-06	53.1	536	0.025	0.045	SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC PE=1 SV=3
7	P05480	3.71e-06	53.1	535	0.025	0.045	SRC_MOUSE Proto-oncogene tyrosine-protein kinase Src OS=Mus musculus OX=10090 GN=Src PE=1 SV=5
8	P00523	3.80e-06	53.1	533	0.025	0.045	SRC_CHICK Proto-oncogene tyrosine-protein kinase Src OS=Gallus gallus OX=9031 GN=SRC PE=1 SV=4
9	Q9WUD9	3.81e-06	53.1	536	0.025	0.045	SRC_RAT Proto-oncogene tyrosine-protein kinase Src OS=Rattus norvegicus OX=10116 GN=Src PE=1 SV=4
10	E1BIM8	4.19e-06	53.1	688	0.025	0.035	E1BIM8_BOVIN Tyrosine-protein kinase OS=Bos taurus OX=9913 GN=SRC PE=3 SV=2
11	P25020	5.79e-06	52.4	526	0.025	0.046	SRC_RSVH1 Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain H-19) OX=11887 GN=V-SRC PE=1 SV=3
12	P09324	1.23e-05	51.6	541	0.029	0.052	YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus OX=9031 GN=YES1 PE=1 SV=3
13	U3NG26	1.58e-05	51.2	568	0.024	0.040	U3NG26_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=BTK PE=1 SV=1
14	Q5JY90	1.73e-05	50.8	483	0.024	0.048	Q5JY90_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=BTK PE=1 SV=1
15	A0A8I6AJ90	1.88e-05	50.8	485	0.027	0.054	A0A8I6AJ90_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=1
16	A0A0G2K6M9	1.93e-05	50.8	661	0.027	0.039	A0A0G2K6M9_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
17	Q5S255	1.95e-05	50.8	660	0.027	0.039	Q5S255_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=2 SV=1
18	Q06187	2.21e-05	50.8	659	0.024	0.035	BTK_HUMAN Tyrosine-protein kinase BTK OS=Homo sapiens OX=9606 GN=BTK PE=1 SV=3
19	A0A0G2K134	2.28e-05	50.8	637	0.027	0.041	A0A0G2K134_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
20	E5RH71	2.59e-05	48.1	175	0.024	0.131	E5RH71_HUMAN FYN proto-oncogene, Src family tyrosine kinase (Fragment) OS=Homo sapiens OX=9606 GN=FYN PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00018 SH3_1	2.6e-06	38.3	SH3 domain
2	PF07653 SH3_2	2.4e-18	77.0	Variant SH3 domain
3	PF14604 SH3_9	4.8e-06	37.7	Variant SH3 domain
4	PF00791 ZU5	0.0076	27.8	ZU5 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386862

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262850	0.974	Ras-related GTP-binding protein B
2	9606.ENSP00000362092	0.964	Ras-related GTP-binding protein C
3	9606.ENSP00000358423	0.953	Ras-related GTP-binding protein D
4	9606.ENSP00000343118	0.944	Ragulator complex protein LAMTOR4
5	9606.ENSP00000369899	0.940	Ras-related GTP-binding protein A
6	9606.ENSP00000278671	0.937	Ragulator complex protein LAMTOR1
7	9606.ENSP00000357288	0.935	Ragulator complex protein LAMTOR2
8	9606.ENSP00000256644	0.934	Ragulator complex protein LAMTOR5
9	9606.ENSP00000424183	0.928	Ragulator complex protein LAMTOR3
10	9606.ENSP00000380074	0.917	Sodium-coupled neutral amino acid transporter 9
11	9606.ENSP00000285393	0.911	V-type proton ATPase subunit d 2
12	9606.ENSP00000290949	0.906	V-type proton ATPase subunit d 1
13	9606.ENSP00000234396	0.903	V-type proton ATPase subunit B, kidney isoform
14	9606.ENSP00000417378	0.902	ATPase H+ transporting V1 subunit F
15	9606.ENSP00000379203	0.901	V-type proton ATPase subunit C 1
16	9606.ENSP00000216442	0.900	V-type proton ATPase subunit D
17	9606.ENSP00000253413	0.900	V-type proton ATPase subunit E 1
18	9606.ENSP00000265686	0.900	V-type proton ATPase 116 kDa subunit a isoform 3
19	9606.ENSP00000272238	0.900	V-type proton ATPase subunit C 2
20	9606.ENSP00000273398	0.900	V-type proton ATPase catalytic subunit A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030695	0.999	GTPase regulator activity
GO:0031267	0.999	small GTPase binding
GO:0042802	0.994	identical protein binding
GO:0005092	0.994	GDP-dissociation inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.986	response to stimulus
GO:0009987	0.986	cellular process
GO:0051179	0.985	localization
GO:0050794	0.985	regulation of cellular process
GO:0051716	0.981	cellular response to stimulus
GO:0009966	0.977	regulation of signal transduction
GO:0032006	0.972	regulation of TOR signaling
GO:0051641	0.967	cellular localization
GO:0048519	0.953	negative regulation of biological process
GO:0070887	0.936	cellular response to chemical stimulus
GO:0001101	0.923	response to acid chemical
GO:0048523	0.921	negative regulation of cellular process
GO:0048518	0.909	positive regulation of biological process
GO:0008104	0.906	protein localization
GO:0048522	0.904	positive regulation of cellular process
GO:0072665	0.901	protein localization to vacuole
GO:0010033	0.893	response to organic substance
GO:0043200	0.873	response to amino acid
GO:1901699	0.868	cellular response to nitrogen compound
GO:0071229	0.852	cellular response to acid chemical
GO:0031323	0.840	regulation of cellular metabolic process
GO:0071417	0.839	cellular response to organonitrogen compound
GO:0071230	0.833	cellular response to amino acid stimulus
GO:0061462	0.767	protein localization to lysosome
GO:0032007	0.751	negative regulation of TOR signaling
GO:0065009	0.739	regulation of molecular function
GO:0009893	0.699	positive regulation of metabolic process
GO:0031325	0.687	positive regulation of cellular metabolic process
GO:0009894	0.646	regulation of catabolic process
GO:0050790	0.569	regulation of catalytic activity
GO:0051336	0.532	regulation of hydrolase activity
GO:0051128	0.532	regulation of cellular component organization
GO:0040008	0.433	regulation of growth
GO:0010506	0.301	regulation of autophagy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005576	0.996	extracellular region
GO:0031982	0.996	vesicle
GO:0070062	0.990	extracellular exosome
GO:0043231	0.972	intracellular membrane-bounded organelle
GO:0005829	0.743	cytosol
GO:0016020	0.494	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]