StarFunc result for job id Q9P0W2

User Input

>input (317 residues)
MSHGPKQPGAAAAPAGGKAPGQHGGFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGK
KRKKILPNGPKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYL
DEAEREKQQYMKELRAYQQSEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNGHKGGDCDGF
STFDVPIFTEEFLDQNKAREAELRRLRKMNVAFEEQNAVLQRHTQSMSSARERLEQELAL
EERRTLALQQQLQAVRQALTASFASLPVPGTGETPTLGTLDFYMARLHGAIERDPAQHEK
LIVRIKEILAQVASEHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P0W2	1.000	1.000	9.289E-45	317	1.000	1.000	Q9P0W2.pdb.gz	HM20B_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=1
2	AFDB:Q9NP66	0.661	0.612	2.504E-24	347	0.476	0.435	Q9NP66.pdb.gz	HM20A_HUMAN High mobility group protein 20A OS=Homo sapiens OX=9606 GN=HMG20A PE=1 SV=1
3	AFDB:B5MDG7	0.306	0.337	2.497E-18	286	0.659	0.731	B5MDG7.pdb.gz	B5MDG7_HUMAN High mobility group 20B (Fragment) OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=2
4	AFDB:K7EJR8	0.372	0.638	2.613E-13	184	0.375	0.647	K7EJR8.pdb.gz	K7EJR8_HUMAN High mobility group 20B (Fragment) OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=1
5	AFDB:Q9BIW6	0.263	0.127	6.256E-6	749	0.224	0.095	Q9BIW6.pdb.gz	Q9BIW6_DROME Brahma-associated protein 111kD OS=Drosophila melanogaster OX=7227 GN=Bap111 PE=2 SV=1
6	AFDB:B7SBD2	0.263	0.157	1.326E-5	577	0.199	0.109	B7SBD2.pdb.gz	TOX3_RAT TOX high mobility group box family member 3 OS=Rattus norvegicus OX=10116 GN=Tox3 PE=1 SV=1
7	AFDB:Q803S1	0.298	0.230	3.542E-5	420	0.233	0.176	Q803S1.pdb.gz	Q803S1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Danio rerio OX=7955 GN=baf57 PE=1 SV=2
8	AFDB:O94900	0.225	0.138	6.689E-5	526	0.139	0.084	O94900.pdb.gz	TOX_HUMAN Thymocyte selection-associated high mobility group box protein TOX OS=Homo sapiens OX=9606 GN=TOX PE=1 SV=3
9	AFDB:Q76IQ7	0.240	0.165	8.429E-5	473	0.123	0.082	Q76IQ7.pdb.gz	TOX2_RAT TOX high mobility group box family member 2 OS=Rattus norvegicus OX=10116 GN=Tox2 PE=2 SV=1
10	AFDB:A0A2R8QK93	0.247	0.108	1.062E-4	774	0.136	0.056	A0A2R8QK93.pdb.gz
11	PDB:1j5nA	0.229	0.676	1.041E-3	93	0.107	0.366	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
12	PDB:5lj5O	0.116	0.128	1.783E-1	283	0.151	0.170	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
13	PDB:7ploI	0.147	0.105	2.381E-1	451	0.041	0.029	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
14	PDB:2b5uA	0.106	0.078	2.140	470	0.069	0.047	2b5uA.pdb.gz
15	PDB:6gym3	0.101	0.191	3.398	138	0.028	0.065	6gym3.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
16	PDB:3jb9W	0.108	0.084	4.042	426	0.126	0.094	3jb9W.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
17	PDB:8escS	0.100	0.113	4.282	268	0.060	0.071	8escS.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
18	PDB:1h7cA	0.093	0.248	4.537	103	0.041	0.126	1h7cA.pdb.gz
19	PDB:7ju42	0.192	0.313	4.807	183	0.091	0.158	7ju42.pdb.gz	Structures of radial spokes and associated complexes important for ciliary motility.
20	PDB:6exnO	0.093	0.092	5.717	320	0.126	0.125	6exnO.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P0W2	0.0	650	317	1.000	1.000	HM20B_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=1
2	Q9Z104	0.0	613	317	0.937	0.937	HM20B_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Mus musculus OX=10090 GN=Hmg20b PE=1 SV=1
3	C9J8X5	1.84e-160	447	215	0.678	1.000	C9J8X5_HUMAN High mobility group 20B (Fragment) OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=1
4	B5MDG7	2.28e-112	328	286	0.678	0.752	B5MDG7_HUMAN High mobility group 20B (Fragment) OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=2
5	C9JQA7	4.43e-100	292	142	0.448	1.000	C9JQA7_HUMAN High mobility group 20B (Fragment) OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=1
6	Q9NP66	2.21e-99	298	347	0.457	0.418	HM20A_HUMAN High mobility group protein 20A OS=Homo sapiens OX=9606 GN=HMG20A PE=1 SV=1
7	Q9DC33	5.44e-97	292	346	0.445	0.408	HM20A_MOUSE High mobility group protein 20A OS=Mus musculus OX=10090 GN=Hmg20a PE=1 SV=1
8	K7EJR8	5.67e-78	238	184	0.379	0.652	K7EJR8_HUMAN High mobility group 20B (Fragment) OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=1
9	Q24537	1.69e-11	66.6	393	0.101	0.081	HMG2_DROME High mobility group protein DSP1 OS=Drosophila melanogaster OX=7227 GN=Dsp1 PE=2 SV=1
10	B4UN11	2.38e-11	61.6	93	0.095	0.323	B4UN11_CANGA Candida glabrata strain CBS138 chromosome H complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0H08541g PE=4 SV=1
11	P11632	4.24e-11	60.8	93	0.091	0.312	NHP6A_YEAST Non-histone chromosomal protein 6A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NHP6A PE=1 SV=1
12	P11633	8.32e-11	60.1	99	0.091	0.293	NHP6B_YEAST Non-histone chromosomal protein 6B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NHP6B PE=1 SV=3
13	Q32L31	1.17e-09	59.3	200	0.079	0.125	HMGB3_BOVIN High mobility group protein B3 OS=Bos taurus OX=9913 GN=HMGB3 PE=2 SV=2
14	Q9UVL1	2.38e-09	55.8	92	0.079	0.272	NHP6_CANAL Non-histone chromosomal protein 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NHP6 PE=3 SV=1
15	O15347	2.91e-09	58.2	200	0.079	0.125	HMGB3_HUMAN High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4
16	O54879	6.82e-09	57.0	200	0.079	0.125	HMGB3_MOUSE High mobility group protein B3 OS=Mus musculus OX=10090 GN=Hmgb3 PE=1 SV=3
17	O15405	7.63e-09	58.9	576	0.107	0.059	TOX3_HUMAN TOX high mobility group box family member 3 OS=Homo sapiens OX=9606 GN=TOX3 PE=1 SV=2
18	P87057	9.21e-09	54.7	108	0.082	0.241	NHP6_SCHPO Non-histone chromosomal protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nhp6 PE=3 SV=1
19	Q803S1	1.26e-08	58.2	420	0.088	0.067	Q803S1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Danio rerio OX=7955 GN=baf57 PE=1 SV=2
20	B4DGM3	1.58e-08	57.8	393	0.085	0.069	B4DGM3_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 OS=Homo sapiens OX=9606 GN=SMARCE1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08651 DASH_Duo1	1.8e+02	13.3	DASH complex subunit Duo1
2	PF00505 HMG_box	6e-16	69.9	HMG (high mobility group) box
3	PF09011 HMG_box_2	1.3e-08	46.7	HMG-box domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328269

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000398824	0.999	PHD finger protein 21A
2	9606.ENSP00000369497	0.996	Breast cancer type 2 susceptibility protein
3	9606.ENSP00000262241	0.993	REST corepressor 1
4	9606.ENSP00000383042	0.992	Lysine-specific histone demethylase 1A
5	9606.ENSP00000430432	0.976	Histone deacetylase 2
6	9606.ENSP00000362649	0.973	Histone deacetylase 1
7	9606.ENSP00000413929	0.935	REST corepressor 3
8	9606.ENSP00000332194	0.925	Histone H2A type 2-C
9	9606.ENSP00000349430	0.920	Histone H2B type 1-K
10	9606.ENSP00000358151	0.919	Histone H2B type 2-E
11	9606.ENSP00000297012	0.916	Histone H2A type 1-A
12	9606.ENSP00000328484	0.916	Histone H2A type 1-J
13	9606.ENSP00000332790	0.916	Histone H2A type 2-B
14	9606.ENSP00000341094	0.916	Histone H2A type 1-D
15	9606.ENSP00000355656	0.916	Histone H2A type 3
16	9606.ENSP00000366679	0.916	Histone H2A type 1-H
17	9606.ENSP00000367022	0.916	Histone H2A type 1-C
18	9606.ENSP00000476136	0.911	Histone H2B type 1-J
19	9606.ENSP00000274764	0.909	Histone H2B type 1-A
20	9606.ENSP00000289316	0.909	Histone H2B type 1-D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.993	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.997	regulation of primary metabolic process
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0051171	0.994	regulation of nitrogen compound metabolic process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0071704	0.987	organic substance metabolic process
GO:0048519	0.987	negative regulation of biological process
GO:0044238	0.982	primary metabolic process
GO:0006807	0.981	nitrogen compound metabolic process
GO:0016043	0.979	cellular component organization
GO:0043170	0.970	macromolecule metabolic process
GO:0009892	0.960	negative regulation of metabolic process
GO:0010468	0.950	regulation of gene expression
GO:0051172	0.949	negative regulation of nitrogen compound metabolic process
GO:0010605	0.947	negative regulation of macromolecule metabolic process
GO:0048518	0.939	positive regulation of biological process
GO:0006325	0.936	chromatin organization
GO:0051246	0.835	regulation of protein metabolic process
GO:0031323	0.833	regulation of cellular metabolic process
GO:1901564	0.797	organonitrogen compound metabolic process
GO:0043412	0.797	macromolecule modification
GO:0036211	0.793	protein modification process
GO:0048523	0.781	negative regulation of cellular process
GO:0019219	0.743	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.736	regulation of cellular biosynthetic process
GO:0006338	0.706	chromatin remodeling
GO:0010556	0.696	regulation of macromolecule biosynthetic process
GO:0051252	0.695	regulation of RNA metabolic process
GO:0006355	0.691	regulation of DNA-templated transcription
GO:0032502	0.676	developmental process
GO:0031399	0.671	regulation of protein modification process
GO:0048856	0.669	anatomical structure development
GO:0050793	0.620	regulation of developmental process
GO:0048522	0.614	positive regulation of cellular process
GO:0018193	0.578	peptidyl-amino acid modification
GO:1903320	0.527	regulation of protein modification by small protein conjugation or removal
GO:0045934	0.465	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.454	negative regulation of RNA metabolic process
GO:0010558	0.449	negative regulation of macromolecule biosynthetic process
GO:0031327	0.449	negative regulation of cellular biosynthetic process
GO:1902679	0.444	negative regulation of RNA biosynthetic process
GO:0030154	0.442	cell differentiation
GO:0045595	0.431	regulation of cell differentiation
GO:1903507	0.427	negative regulation of nucleic acid-templated transcription
GO:0048513	0.421	animal organ development
GO:0009888	0.406	tissue development
GO:0045892	0.403	negative regulation of DNA-templated transcription
GO:0061061	0.399	muscle structure development
GO:0006357	0.371	regulation of transcription by RNA polymerase II
GO:0031400	0.318	negative regulation of protein modification process
GO:0018205	0.310	peptidyl-lysine modification
GO:0009893	0.307	positive regulation of metabolic process
GO:0010604	0.301	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016604	0.984	nuclear body
GO:0032991	0.848	protein-containing complex
GO:0005737	0.332	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]