StarFunc result for job id Q9P0X4

User Input

>input (2223 residues)
MAESASPPSSSAAAPAAEPGVTTEQPGPRSPPSSPPGLEEPLDGADPHVPHPDLAPIAFF
CLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMDCLSDRCKILQVFDD
FIFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTV
RVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCF
LEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDV
YDFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWV
EIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYL
SSSTVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQSRRQALGPEAPAPAKPGPH
AKEPRHYHGKTKGQGDEGRHLGSRHCQTLHGPASPGNDHSGRELCPQHSPLDATPHTLVQ
PIPATLASDPASCPCCQHEDGRRPSGLGSTDSGQEGSGSGSSAGGEDEADGDGARSSEDG
ASSELGKEEEEEEQADGAVWLCGDVWRETRAKLRGIVDSKYFNRGIMMAILVNTVSMGIE
HHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIV
GQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILG
MHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASL
YFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDEDQSSSNIEEFDKLQEGLDSSGD
PKLCPIPMTPNGHLDPSLPLGGHLGPAGAAGPAPRLSLQPDPMLVALGSRKSSVMSLGRM
SYDQRSLSSSRSSYYGPWGRSAAWASRRSSWNSLKHKPPSAEHESLLSAERGGGARVCEV
AADEGPPRAAPLHTPHAHHIHHGPHLAHRHRHHRRTLSLDNRDSVDLAELVPAVGAHPRA
AWRAAGPAPGHEDCNGRMPSIAKDVFTKMGDRGDRGEDEEEIDYTLCFRVRKMIDVYKPD
WCEVREDWSVYLFSPENRFRVLCQTIIAHKLFDYVVLAFIFLNCITIALERPQIEAGSTE
RIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSLA
SAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIF
GILGVQLFKGKFYHCLGVDTRNITNRSDCMAANYRWVHHKYNFDNLGQALMSLFVLASKD
GWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQH
QEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCHTRLLIHSMCTSHYLDIFITFIICLN
VVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVL
LSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVG
NLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNW
NGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEA
QEDAEMDAELELEMAHGLGPGPRLPTGSPGAPGRGPGGAGGGGDTEGGLCRRCYSPAQEN
LWLDSVSLIIKDSLEGELTIIDNLSGSIFHHYSSPAGCKKCHHDKQEVQLAETEAFSLNS
DRSSSILLGDDLSLEDPTACPPGRKDSKGELDPPEPMRVGDLGECFFPLSSTAVSPDPEN
FLCEMEEIPFNPVRSWLKHDSSQAPPSPFSPDASSPLLPMPAEFFHPAVSASQKGPEKGT
GTGTLPKIALQGSWASLRSPRVNCTLLRQATGSDTSLDASPSSSAGSLQTTLEDSLTLSD
SPRRALGPPAPAPGPRAGLSPAARRRLSLRGRGLFSLRGLRAHQRSHSSGGSTSPGCTHH
DSMDPSDEEGRGGAGGGGAGSEHSETLSSLSLTSLFCPPPPPPAPGLTPARKFSSTSSLA
APGRPHAAALAHGLARSPSWAADRSKDPPGRAPLPMGLGPLAPPPQPLPGELEPGDAASK
RKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7wliA	0.499	0.967	0.000	1135	0.508	0.995	7wliA.pdb.gz	Structure, gating, and pharmacology of human Ca V 3.3 channel.
2	AFDB:O54898	0.604	0.596	0.000	2254	0.527	0.520	O54898.pdb.gz	CAC1G_RAT Voltage-dependent T-type calcium channel subunit alpha-1G OS=Rattus norvegicus OX=10116 GN=Cacna1g PE=1 SV=2
3	AFDB:O88427	0.618	0.583	0.000	2365	0.565	0.531	O88427.pdb.gz	CAC1H_MOUSE Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus OX=10090 GN=Cacna1h PE=1 SV=3
4	AFDB:O95180	0.633	0.600	0.000	2353	0.562	0.531	O95180.pdb.gz	CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens OX=9606 GN=CACNA1H PE=1 SV=4
5	AFDB:Q5SUF7	0.606	0.568	0.000	2381	0.548	0.512	Q5SUF7.pdb.gz	Q5SUF7_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
6	AFDB:Q9P0X4	1.000	1.000	0.000	2223	1.000	1.000	Q9P0X4.pdb.gz	CAC1I_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1I OS=Homo sapiens OX=9606 GN=CACNA1I PE=1 SV=1
7	AFDB:Q9Z0Y8	0.709	0.715	0.000	2201	0.917	0.926	Q9Z0Y8.pdb.gz	CAC1I_RAT Voltage-dependent T-type calcium channel subunit alpha-1I OS=Rattus norvegicus OX=10116 GN=Cacna1i PE=1 SV=3
8	PDB:6kzoA	0.428	0.975	1.967E-80	967	0.356	0.818	6kzoA.pdb.gz	Cryo-EM structures of apo and antagonist-bound human Cav3.1.
9	AFDB:A0A0R4IFN9	0.478	0.460	3.983E-69	2319	0.248	0.238	A0A0R4IFN9.pdb.gz
10	AFDB:P15381	0.500	0.512	4.151E-69	2171	0.231	0.237	P15381.pdb.gz	CAC1C_RABIT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Oryctolagus cuniculus OX=9986 GN=CACNA1C PE=1 SV=1
11	AFDB:Q00975	0.483	0.460	1.355E-67	2339	0.244	0.232	Q00975.pdb.gz	CAC1B_HUMAN Voltage-dependent N-type calcium channel subunit alpha-1B OS=Homo sapiens OX=9606 GN=CACNA1B PE=1 SV=1
12	AFDB:P97445	0.478	0.450	7.740E-67	2368	0.242	0.228	P97445.pdb.gz	CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus OX=10090 GN=Cacna1a PE=1 SV=2
13	PDB:7xveA	0.451	0.762	1.310E-52	1276	0.168	0.293	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
14	PDB:7vfsA	0.450	0.764	1.826E-52	1266	0.172	0.303	7vfsA.pdb.gz	Closed-state inactivation and pore-blocker modulation mechanisms of human Ca V 2.2.
15	PDB:7w9lA	0.464	0.714	1.231E-51	1420	0.173	0.270	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
16	PDB:7mixA	0.446	0.729	2.766E-50	1326	0.165	0.277	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
17	PDB:6j8gA	0.455	0.866	2.825E-49	1140	0.165	0.321	6j8gA.pdb.gz	Structures of human Nav1.7 channel in complex with auxiliary subunits and animal toxins.
18	PDB:7we4A	0.449	0.863	3.070E-49	1122	0.149	0.296	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
19	PDB:6j8eA	0.449	0.849	8.667E-47	1139	0.160	0.313	6j8eA.pdb.gz	Molecular basis for pore blockade of human Na+channel Nav1.2 by the mu-conotoxin KIIIA.
20	PDB:7uhfA	0.439	0.776	9.035E-47	1230	0.175	0.317	7uhfA.pdb.gz	Structural basis for pore blockade of human voltage-gated calcium channel Ca v 1.3 by motion sickness drug cinnarizine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A8JUY8	753	3205	0.175	0.122	A8JUY8_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform C OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
2	E0CXK2	3135	1835	0.774	0.938	E0CXK2_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1i PE=1 SV=1
3	E9PWL1	1313	2272	0.346	0.338	E9PWL1_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
4	E9Q7P2	3660	2199	0.916	0.926	E9Q7P2_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1i PE=1 SV=1
5	G5EBS2	663	1837	0.168	0.204	G5EBS2_CAEEL Voltage-dependent T-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cca-1 PE=2 SV=1
6	M9NDQ0	753	3200	0.175	0.122	M9NDQ0_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform E OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
7	M9NGR9	753	3180	0.175	0.123	M9NGR9_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform D OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
8	M9PGH9	753	3218	0.175	0.121	M9PGH9_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform F OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
9	O43497	1334	2377	0.390	0.365	CAC1G_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1G OS=Homo sapiens OX=9606 GN=CACNA1G PE=1 SV=3
10	O54898	1311	2254	0.342	0.337	CAC1G_RAT Voltage-dependent T-type calcium channel subunit alpha-1G OS=Rattus norvegicus OX=10116 GN=Cacna1g PE=1 SV=2
11	O88427	1505	2365	0.381	0.358	CAC1H_MOUSE Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus OX=10090 GN=Cacna1h PE=1 SV=3
12	O95180	1468	2353	0.384	0.363	CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens OX=9606 GN=CACNA1H PE=1 SV=4
13	Q27YN9	1311	2265	0.352	0.345	Q27YN9_MOUSE T-type calcium channel alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=2 SV=1
14	Q3UQG9	605	853	0.150	0.390	Q3UQG9_MOUSE Ion transport domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Cacna1g PE=2 SV=1
15	Q5SUF5	1323	2247	0.352	0.348	Q5SUF5_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
16	Q5SUF6	1299	2288	0.350	0.340	Q5SUF6_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
17	Q5SUF7	1327	2381	0.369	0.344	Q5SUF7_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
18	Q5SUF8	1323	2254	0.350	0.346	Q5SUF8_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
19	Q5SUF9	1311	2265	0.352	0.345	Q5SUF9_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
20	Q5SUG0	1311	2277	0.349	0.341	Q5SUG0_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00520 Ion_trans	1.1e-252	845.2	Ion transport protein
2	PF08016 PKD_channel	2.8e-15	67.9	Polycystin cation channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385019

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341940	0.884	Caveolin-3
2	9606.ENSP00000262839	0.856	Short transient receptor potential channel 5
3	9606.ENSP00000419313	0.845	Short transient receptor potential channel 1
4	9606.ENSP00000369027	0.844	Short transient receptor potential channel 4
5	9606.ENSP00000320025	0.839	Voltage-dependent L-type calcium channel subunit beta-2
6	9606.ENSP00000352011	0.825	Voltage-dependent T-type calcium channel subunit alpha-1G
7	9606.ENSP00000334198	0.821	Voltage-dependent T-type calcium channel subunit alpha-1H
8	9606.ENSP00000343925	0.821	Estrogen receptor beta
9	9606.ENSP00000477999	0.808	Nitric oxide synthase, brain
10	9606.ENSP00000480132	0.778	Neural cell adhesion molecule 1
11	9606.ENSP00000438949	0.740	Voltage-dependent L-type calcium channel subunit beta-4
12	9606.ENSP00000377840	0.732	Voltage-dependent L-type calcium channel subunit beta-1
13	9606.ENSP00000301050	0.729	Voltage-dependent L-type calcium channel subunit beta-3
14	9606.ENSP00000333496	0.721	Potassium voltage-gated channel subfamily D member 2
15	9606.ENSP00000222693	0.720	Caveolin-2
16	9606.ENSP00000322460	0.710	Sodium channel subunit beta-4
17	9606.ENSP00000290039	0.704	VWFA and cache domain-containing protein 1
18	9606.ENSP00000419081	0.694	Calmodulin-like protein 4
19	9606.ENSP00000396915	0.690	Sodium channel subunit beta-1
20	9606.ENSP00000272298	0.689	Calmodulin 2 (phosphorylase kinase, delta)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005245	1.000	voltage-gated calcium channel activity
GO:0008332	0.907	low voltage-gated calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0009987	0.992	cellular process
GO:0050789	0.984	regulation of biological process
GO:0050896	0.966	response to stimulus
GO:0050794	0.965	regulation of cellular process
GO:0007154	0.917	cell communication
GO:0051179	0.762	localization
GO:0006810	0.727	transport
GO:0023052	0.716	signaling
GO:0042391	0.683	regulation of membrane potential
GO:0006811	0.638	monoatomic ion transport
GO:0030001	0.632	metal ion transport
GO:0055085	0.513	transmembrane transport
GO:0051716	0.486	cellular response to stimulus
GO:0006816	0.430	calcium ion transport
GO:0008016	0.361	regulation of heart contraction
GO:0032501	0.346	multicellular organismal process
GO:0098655	0.342	monoatomic cation transmembrane transport
GO:0098660	0.315	inorganic ion transmembrane transport
GO:0098662	0.310	inorganic cation transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.861	protein-containing complex
GO:0098796	0.757	membrane protein complex
GO:0034702	0.753	ion channel complex
GO:0034703	0.619	cation channel complex
GO:0098797	0.426	plasma membrane protein complex
GO:0005622	0.384	intracellular anatomical structure
GO:0034704	0.335	calcium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]