StarFunc result for job id Q9P0Z9

User Input

>input (390 residues)
MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHGQSRIIRKAYL
EDFYTRMMHECYQIWAQLEHEAGTQLHRQTGLLLLGMKENQELKTIQANLSRQRVEHQCL
SSEELKQRFPNIRLPRGEVGLLDNSGGVIYAYKALRALQDAIRQLGGIVRDGEKVVEINP
GLLVTVKTTSRSYQAKSLVITAGPWTNQLLRPLGIEMPLQTLRINVCYWREMVPGSYGVS
QAFPCFLWLGLCPHHIYGLPTGEYPGLMKVSYHHGNHADPEERDCPTARTDIGDVQILSS
FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKI
LYELSMKLTPSYDLAPFRISRFPSLGKAHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P0Z9	1.000	1.000	8.668E-91	390	1.000	1.000	Q9P0Z9.pdb.gz	SOX_HUMAN Peroxisomal sarcosine oxidase OS=Homo sapiens OX=9606 GN=PIPOX PE=1 SV=2
2	AFDB:Q9D826	0.986	0.986	1.759E-76	390	0.810	0.810	Q9D826.pdb.gz	SOX_MOUSE Peroxisomal sarcosine oxidase OS=Mus musculus OX=10090 GN=Pipox PE=1 SV=1
3	AFDB:Q9SJA7	0.928	0.871	1.697E-46	416	0.344	0.322	Q9SJA7.pdb.gz	SOX_ARATH Probable sarcosine oxidase OS=Arabidopsis thaliana OX=3702 GN=At2g24580 PE=2 SV=1
4	AFDB:P40874	0.886	0.927	1.031E-40	372	0.274	0.288	P40874.pdb.gz	MTOX_ECOLI N-methyl-L-tryptophan oxidase OS=Escherichia coli (strain K12) OX=83333 GN=solA PE=1 SV=1
5	PDB:2uzzB	0.890	0.932	1.984E-39	372	0.274	0.288	2uzzB.pdb.gz	The X-Ray Structure of N-Methyltryptophan Oxidase Reveals the Structural Determinants of Substrate Specificity.
6	AFDB:O43029	0.793	0.754	2.410E-27	412	0.238	0.226	O43029.pdb.gz	FAP1_SCHPO L-pipecolate oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fap1 PE=1 SV=1
7	PDB:4yshA	0.758	0.796	1.620E-26	370	0.190	0.200	4yshA.pdb.gz	Crystal structure of glycine oxidase from Geobacillus kaustophilus
8	AFDB:Q5L2C2	0.781	0.806	2.092E-26	377	0.192	0.199	Q5L2C2.pdb.gz	GLYOX_GEOKA Glycine oxidase OS=Geobacillus kaustophilus (strain HTA426) OX=235909 GN=thiO PE=1 SV=1
9	AFDB:Q8NCN5	0.832	0.385	5.988E-26	879	0.221	0.098	Q8NCN5.pdb.gz	PDPR_HUMAN Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Homo sapiens OX=9606 GN=PDPR PE=1 SV=2
10	AFDB:Q5JFG7	0.814	0.822	6.730E-26	386	0.192	0.194	Q5JFG7.pdb.gz	Q5JFG7_THEKO Sarcosine oxidase, beta subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK0117 PE=4 SV=1
11	AFDB:Q9UTM9	0.778	0.706	3.454E-25	433	0.215	0.194	Q9UTM9.pdb.gz	FAP2_SCHPO L-saccharopine oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fap2 PE=1 SV=1
12	AFDB:Q9HTE8	0.817	0.769	3.882E-25	416	0.187	0.175	Q9HTE8.pdb.gz	Q9HTE8_PSEAE Sarcosine oxidase beta subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=soxB PE=4 SV=1
13	PDB:4pabB	0.799	0.397	5.260E-24	824	0.210	0.100	4pabB.pdb.gz	Folate in demethylation: The crystal structure of the rat dimethylglycine dehydrogenase complexed with tetrahydrofolate.
14	PDB:3nycA	0.815	0.833	1.339E-23	381	0.187	0.192	3nycA.pdb.gz	Conformational changes and substrate recognition in Pseudomonas aeruginosa D-arginine dehydrogenase.
15	PDB:3if9A	0.754	0.803	1.794E-23	364	0.190	0.203	3if9A.pdb.gz	Glyphosate resistance by engineering the flavoenzyme glycine oxidase.
16	PDB:5oc2A	0.742	0.663	2.889E-21	441	0.213	0.188	5oc2A.pdb.gz	Thermal stabilization of the deglycating enzyme Amadoriase I by rational design.
17	PDB:3awiD	0.719	0.448	4.932E-19	659	0.136	0.080	3awiD.pdb.gz	Crystal structure of the bifunctional tRNA modification enzyme MnmC from Escherichia coli
18	PDB:2qcuB	0.678	0.541	3.627E-16	501	0.151	0.118	2qcuB.pdb.gz	Structure of glycerol-3-phosphate dehydrogenase, an essential monotopic membrane enzyme involved in respiration and metabolism.
19	PDB:3ihgA	0.498	0.381	3.453E-14	535	0.172	0.125	3ihgA.pdb.gz	Structural basis for substrate recognition and specificity in aklavinone-11-hydroxylase from rhodomycin biosynthesis.
20	PDB:5dbjE	0.496	0.450	1.577E-13	437	0.149	0.133	5dbjE.pdb.gz	Crystal structure of halogenase PltA from the pyoluteorin biosynthetic pathway.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9D826	0.0	648	390	0.810	0.810	SOX_MOUSE Peroxisomal sarcosine oxidase OS=Mus musculus OX=10090 GN=Pipox PE=1 SV=1
2	Q9P0Z9	0.0	811	390	1.000	1.000	SOX_HUMAN Peroxisomal sarcosine oxidase OS=Homo sapiens OX=9606 GN=PIPOX PE=1 SV=2
3	Q9SJA7	3.06e-70	228	416	0.344	0.322	SOX_ARATH Probable sarcosine oxidase OS=Arabidopsis thaliana OX=3702 GN=At2g24580 PE=2 SV=1
4	P40874	1.04e-44	160	372	0.290	0.304	MTOX_ECOLI N-methyl-L-tryptophan oxidase OS=Escherichia coli (strain K12) OX=83333 GN=solA PE=1 SV=1
5	O43029	1.06e-19	92.4	412	0.246	0.233	FAP1_SCHPO L-pipecolate oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fap1 PE=1 SV=1
6	Q9UTM9	3.64e-12	69.7	433	0.208	0.187	FAP2_SCHPO L-saccharopine oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fap2 PE=1 SV=1
7	Q4WIF5	3.66e-12	69.7	445	0.249	0.218	Q4WIF5_ASPFU Fructosyl amine:oxygen oxidoreductase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_2G02030 PE=1 SV=1
8	Q2U0E2	2.40e-10	64.3	445	0.226	0.198	Q2U0E2_ASPOR FAD dependent oxidoreductase domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000473 PE=4 SV=1
9	Q5JFG7	5.43e-09	59.7	386	0.213	0.215	Q5JFG7_THEKO Sarcosine oxidase, beta subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK0117 PE=4 SV=1
10	A1ZAZ2	6.93e-09	60.1	894	0.210	0.092	A1ZAZ2_DROME Sarcosine dehydrogenase OS=Drosophila melanogaster OX=7227 GN=Sardh PE=1 SV=1
11	Q63342	9.22e-09	59.7	857	0.228	0.104	M2GD_RAT Dimethylglycine dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Dmgdh PE=1 SV=1
12	Q9DBT9	1.39e-08	59.3	869	0.223	0.100	M2GD_MOUSE Dimethylglycine dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Dmgdh PE=1 SV=1
13	Q8IGS5	1.48e-08	58.9	907	0.167	0.072	Q8IGS5_DROME RE37361p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Sardh PE=2 SV=1
14	Q3TQB2	1.55e-08	58.5	487	0.241	0.193	FXRD1_MOUSE FAD-dependent oxidoreductase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Foxred1 PE=1 SV=1
15	Q4WMF9	3.07e-08	57.8	438	0.203	0.180	Q4WMF9_ASPFU Fructosyl amine: oxygen oxidoreductase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_6G10040 PE=4 SV=1
16	Q2UHU5	5.08e-08	57.0	436	0.221	0.197	Q2UHU5_ASPOR FAD dependent oxidoreductase domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000307 PE=4 SV=1
17	Q8NCN5	7.65e-08	57.0	879	0.241	0.107	PDPR_HUMAN Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Homo sapiens OX=9606 GN=PDPR PE=1 SV=2
18	Q9UI17	1.54e-07	55.8	866	0.141	0.064	M2GD_HUMAN Dimethylglycine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DMGDH PE=1 SV=2
19	Q7TSQ8	3.29e-06	51.6	878	0.238	0.106	PDPR_MOUSE Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Mus musculus OX=10090 GN=Pdpr PE=1 SV=1
20	G5EB56	7.59e-06	50.1	438	0.159	0.142	G5EB56_EMENI FAD dependent oxidoreductase domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08123 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02558 ApbA	1.9e+02	13.1	Ketopantoate reductase PanE/ApbA
2	PF01266 DAO	2.5e-50	183.7	FAD dependent oxidoreductase
3	PF00890 FAD_binding_2	11	16.6	FAD binding domain
4	PF01134 GIDA	7.6	17.1	Glucose inhibited division protein A
5	PF03486 HI0933_like	0.74	20.1	HI0933-like protein
6	PF13450 NAD_binding_8	0.038	25.5	NAD(P)-binding Rossmann-like domain
7	PF07992 Pyr_redox_2	0.9	20.3	Pyridine nucleotide-disulphide oxidoreductase
8	PF13738 Pyr_redox_3	2.2e+02	12.5	Pyridine nucleotide-disulphide oxidoreductase
9	PF01946 Thi4	7.5e+02	10.7	Thi4 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317721

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302620	0.987	Alanine-glyoxylate aminotransferase
2	9606.ENSP00000483507	0.984	Hydroxyacid oxidase 2
3	9606.ENSP00000355607	0.977	Glyceronephosphate O-acyltransferase
4	9606.ENSP00000217455	0.973	Acyl-coenzyme A thioesterase 8
5	9606.ENSP00000369461	0.973	Enoyl-CoA delta isomerase 2, mitochondrial
6	9606.ENSP00000368066	0.972	Hydroxyacid oxidase 1
7	9606.ENSP00000221418	0.971	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
8	9606.ENSP00000231887	0.971	Peroxisomal bifunctional enzyme
9	9606.ENSP00000285737	0.971	Lon protease homolog 2, peroxisomal
10	9606.ENSP00000265322	0.967	Peroxisomal trans-2-enoyl-CoA reductase
11	9606.ENSP00000371517	0.966	Alpha-methylacyl-CoA racemase
12	9606.ENSP00000307697	0.965	Peroxisomal acyl-coenzyme A oxidase 2
13	9606.ENSP00000323071	0.965	Acyl-coenzyme A thioesterase 4
14	9606.ENSP00000413575	0.963	Peroxisomal carnitine O-octanoyltransferase
15	9606.ENSP00000357920	0.959	D-aspartate oxidase
16	9606.ENSP00000348775	0.958	Peroxisomal acyl-coenzyme A oxidase 3
17	9606.ENSP00000228476	0.955	D-amino-acid oxidase
18	9606.ENSP00000293217	0.954	Peroxisomal acyl-coenzyme A oxidase 1
19	9606.ENSP00000360938	0.952	Sarcosine dehydrogenase, mitochondrial
20	9606.ENSP00000262430	0.951	Malonyl-CoA decarboxylase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016647	1.000	oxidoreductase activity, acting on the CH-NH group of donors, oxygen as acceptor
GO:0005515	0.997	protein binding
GO:0036094	0.754	small molecule binding
GO:1901363	0.705	heterocyclic compound binding
GO:0097159	0.705	organic cyclic compound binding
GO:0043167	0.689	ion binding
GO:0043168	0.640	anion binding
GO:0008115	0.591	sarcosine oxidase activity
GO:0000166	0.542	nucleotide binding
GO:0050660	0.332	flavin adenine dinucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.995	primary metabolic process
GO:0046395	0.995	carboxylic acid catabolic process
GO:0009063	0.992	amino acid catabolic process
GO:0006790	0.991	sulfur compound metabolic process
GO:1901606	0.991	alpha-amino acid catabolic process
GO:0006553	0.985	lysine metabolic process
GO:0006163	0.985	purine nucleotide metabolic process
GO:0043603	0.984	amide metabolic process
GO:0006637	0.974	acyl-CoA metabolic process
GO:0009068	0.970	aspartate family amino acid catabolic process
GO:0006084	0.959	acetyl-CoA metabolic process
GO:0043605	0.946	amide catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005777	0.999	peroxisome
GO:0070013	0.997	intracellular organelle lumen
GO:0005829	0.972	cytosol
GO:0005782	0.910	peroxisomal matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.5.3.-	1.000	With oxygen as acceptor.
RHEA:13313	0.591	H2O + O2 + sarcosine = formaldehyde + glycine + H2O2
EC:1.5.3.1	0.591	sarcosine oxidasee (formaldehyde-forming).

[back to server]