StarFunc result for job id Q9P107

User Input

>input (970 residues)
MDAAEPGLPPGPEGRKRYSDIFRSLDNLEISLGNVTLEMLAGDPLLSEDPEPDKTPTATV
TNEASCWSGPSPEGPVPLTGEELDLRLIRTKGGVDAALEYAKTWSRYAKELLAWTEKRAS
YELEFAKSTMKIAEAGKVSIQQQSHMPLQYIYTLFLEHDLSLGTLAMETVAQQKRDYYQP
LAAKRTEIEKWRKEFKEQWMKEQKRMNEAVQALRRAQLQYVQRSEDLRARSQGSPEDSAP
QASPGPSKQQERRRRSREEAQAKAQEAEALYQACVREANARQQDLEIAKQRIVSHVRKLV
FQGDEVLRRVTLSLFGLRGAQAERGPRAFAALAECCAPFEPGQRYQEFVRALRPEAPPPP
PPAFSFQEFLPSLNSSPLDIRKKLSGPLPPRLDENSAEPGPWEDPGTGWRWQGTPGPTPG
SDVDSVGGGSESRSLDSPTSSPGAGTRQLVKASSTGTESSDDFEERDPDLGDGLENGLGS
PFGKWTLSSAAQTHQLRRLRGPAKCRECEAFMVSGTECEECFLTCHKRCLETLLILCGHR
RLPARTPLFGVDFLQLPRDFPEEVPFVVTKCTAEIEHRALDVQGIYRVSGSRVRVERLCQ
AFENGRALVELSGNSPHDVSSVLKRFLQELTEPVIPFHLYDAFISLAKTLHADPGDDPGT
PSPSPEVIRSLKTLLVQLPDSNYNTLRHLVAHLFRVAARFMENKMSANNLGIVFGPTLLR
PPDGPRAASAIPVTCLLDSGHQAQLVEFLIVHYEQIFGMDELPQATEPPPQDSSPAPGPL
TTSSQPPPPHLDPDSQPPVLASDPGPDPQHHSTLEQHPTATPTEIPTPQSDQREDVAEDT
KDGGGEVSSQGPEDSLLGTQSRGHFSRQPVKYPRGGVRPVTHQLSSLALVASKLCEETPI
TSVPRGSLRGRGPSPAAASPEGSPLRRTPLPKHFEITQETARLLSKLDSEAVPRATCCPD
VQPEEAEDHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R7N1	0.470	0.470	0.000	970	1.000	1.000	A0A024R7N1.pdb.gz	A0A024R7N1_HUMAN GMIP (Fragment) OS=Homo sapiens OX=9606 GN=GMIP PE=4 SV=1
2	AFDB:Q52LW3	0.434	0.348	2.685E-50	1261	0.323	0.248	Q52LW3.pdb.gz	RHG29_HUMAN Rho GTPase-activating protein 29 OS=Homo sapiens OX=9606 GN=ARHGAP29 PE=1 SV=2
3	AFDB:Q8CGF1	0.443	0.350	3.476E-50	1266	0.328	0.251	Q8CGF1.pdb.gz	RHG29_MOUSE Rho GTPase-activating protein 29 OS=Mus musculus OX=10090 GN=Arhgap29 PE=1 SV=1
4	AFDB:K7EM85	0.355	0.310	1.781E-45	1163	0.337	0.281	K7EM85.pdb.gz	K7EM85_HUMAN Rho GTPase activating protein 45 OS=Homo sapiens OX=9606 GN=ARHGAP45 PE=1 SV=1
5	AFDB:Q54GD0	0.267	0.280	7.802E-18	920	0.141	0.149	Q54GD0.pdb.gz	MGP1_DICDI GTPase activating protein homolog 1 OS=Dictyostelium discoideum OX=44689 GN=mgp1 PE=3 SV=1
6	AFDB:X2JDY8	0.176	0.167	4.177E-15	1025	0.137	0.130	X2JDY8.pdb.gz	RHGF_DROME Rho GTPase-activating protein Graf OS=Drosophila melanogaster OX=7227 GN=Graf PE=1 SV=1
7	AFDB:Q6P3H8	0.191	0.277	4.552E-15	654	0.143	0.213	Q6P3H8.pdb.gz	Q6P3H8_DANRE Rac GTPase-activating protein 1 OS=Danio rerio OX=7955 GN=ogr PE=1 SV=1
8	PDB:3cxlA	0.193	0.453	1.183E-12	402	0.090	0.216	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
9	PDB:1xa6A	0.195	0.461	1.669E-12	399	0.092	0.223	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
10	AFDB:Q8C170	0.191	0.075	1.198E-11	2542	0.138	0.053	Q8C170.pdb.gz	MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus OX=10090 GN=Myo9a PE=1 SV=2
11	PDB:6r3vA	0.184	0.839	8.746E-11	198	0.064	0.313	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
12	PDB:5c2kA	0.184	0.448	6.752E-9	382	0.064	0.162	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
13	PDB:5jcpA	0.176	0.462	1.084E-8	361	0.056	0.150	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
14	AFDB:Q9VIS1	0.197	0.105	1.617E-7	1843	0.111	0.059	Q9VIS1.pdb.gz	CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster OX=7227 GN=CdGAPr PE=1 SV=2
15	AFDB:Q09822	0.254	0.265	1.762E-7	927	0.132	0.138	Q09822.pdb.gz	CDC15_SCHPO Cell division control protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc15 PE=1 SV=2
16	PDB:6ikoA	0.242	0.715	4.780E-5	303	0.049	0.158	6ikoA.pdb.gz
17	PDB:3hajA	0.178	0.496	2.913E-4	286	0.037	0.126	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
18	PDB:4o9yA	0.110	0.055	6.317E-2	2490	0.049	0.019	4o9yA.pdb.gz
19	PDB:5lkiA	0.102	0.075	1.852E-1	1427	0.043	0.029	5lkiA.pdb.gz
20	PDB:6q0xA	0.140	0.326	4.774E-1	373	0.026	0.067	6q0xA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R7N1	0.0	1971	970	1.000	1.000	A0A024R7N1_HUMAN GMIP (Fragment) OS=Homo sapiens OX=9606 GN=GMIP PE=4 SV=1
2	Q9P107	0.0	1971	970	1.000	1.000	GMIP_HUMAN GEM-interacting protein OS=Homo sapiens OX=9606 GN=GMIP PE=1 SV=2
3	Q52LW3	5.54e-151	481	1261	0.313	0.241	RHG29_HUMAN Rho GTPase-activating protein 29 OS=Homo sapiens OX=9606 GN=ARHGAP29 PE=1 SV=2
4	Q8CGF1	1.67e-150	480	1266	0.316	0.242	RHG29_MOUSE Rho GTPase-activating protein 29 OS=Mus musculus OX=10090 GN=Arhgap29 PE=1 SV=1
5	F5H1R4	1.53e-141	450	1019	0.310	0.295	F5H1R4_HUMAN Rho GTPase activating protein 45 OS=Homo sapiens OX=9606 GN=ARHGAP45 PE=1 SV=1
6	Q92619	4.98e-141	452	1136	0.310	0.265	HMHA1_HUMAN Rho GTPase-activating protein 45 OS=Homo sapiens OX=9606 GN=ARHGAP45 PE=1 SV=2
7	K7ES98	1.02e-140	451	1140	0.310	0.264	K7ES98_HUMAN Rho GTPase activating protein 45 OS=Homo sapiens OX=9606 GN=ARHGAP45 PE=1 SV=1
8	K7EM85	1.06e-140	452	1163	0.310	0.259	K7EM85_HUMAN Rho GTPase activating protein 45 OS=Homo sapiens OX=9606 GN=ARHGAP45 PE=1 SV=1
9	K7ES92	4.02e-100	333	771	0.238	0.300	K7ES92_HUMAN Rho GTPase activating protein 45 OS=Homo sapiens OX=9606 GN=ARHGAP45 PE=1 SV=1
10	G5EF80	6.48e-44	175	966	0.181	0.182	G5EF80_CAEEL F-BAR domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=spv-1 PE=1 SV=1
11	Q03070	3.84e-34	135	295	0.092	0.302	CHIO_RAT Beta-chimaerin OS=Rattus norvegicus OX=10116 GN=Chn2 PE=2 SV=1
12	P52757	1.43e-31	131	468	0.093	0.192	CHIO_HUMAN Beta-chimaerin OS=Homo sapiens OX=9606 GN=CHN2 PE=1 SV=2
13	P30337	3.20e-31	127	334	0.093	0.269	CHIN_RAT N-chimaerin OS=Rattus norvegicus OX=10116 GN=Chn1 PE=1 SV=2
14	Q91V57	2.40e-30	127	459	0.093	0.196	CHIN_MOUSE N-chimaerin OS=Mus musculus OX=10090 GN=Chn1 PE=1 SV=2
15	Q7ZUT6	2.51e-30	127	459	0.100	0.211	Q7ZUT6_DANRE Chimerin (Chimaerin) 1 OS=Danio rerio OX=7955 GN=chimaerin PE=1 SV=1
16	P15882	3.67e-30	127	459	0.103	0.218	CHIN_HUMAN N-chimaerin OS=Homo sapiens OX=9606 GN=CHN1 PE=1 SV=3
17	E7F3F0	6.95e-27	121	2286	0.084	0.035	MY9AB_DANRE Unconventional myosin-IXAb OS=Danio rerio OX=7955 GN=myo9ab PE=3 SV=3
18	Q8C170	1.01e-26	120	2542	0.082	0.031	MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus OX=10090 GN=Myo9a PE=1 SV=2
19	B2RTY4	1.41e-26	120	2548	0.082	0.031	MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens OX=9606 GN=MYO9A PE=1 SV=2
20	E7EZG2	1.72e-26	120	2522	0.102	0.039	MY9AA_DANRE Unconventional myosin-IXAa OS=Danio rerio OX=7955 GN=myo9aa PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	0.074	24.3	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF00620 RhoGAP	2.7e-44	162.1	RhoGAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000203556

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298229	0.755	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
2	9606.ENSP00000204679	0.702	N-acetylglucosamine-1-phosphotransferase subunit gamma
3	9606.ENSP00000440704	0.659	Synaptotagmin-like protein 1
4	9606.ENSP00000400175	0.654	Transforming protein RhoA
5	9606.ENSP00000383118	0.653	Cell division control protein 42 homolog
6	9606.ENSP00000337572	0.621	Diacylglycerol kinase eta
7	9606.ENSP00000373169	0.604	D(3) dopamine receptor
8	9606.ENSP00000297596	0.578	GTP-binding protein GEM
9	9606.ENSP00000468049	0.563	Zinc finger protein 101
10	9606.ENSP00000349877	0.554	Manganese-transporting ATPase 13A1
11	9606.ENSP00000344871	0.539	Unconventional myosin-If
12	9606.ENSP00000403323	0.535	Rho GTPase-activating protein 27
13	9606.ENSP00000262428	0.519	Coactosin-like protein
14	9606.ENSP00000267396	0.517	GTP-binding protein REM 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0009987	0.994	cellular process
GO:0051056	0.989	regulation of small GTPase mediated signal transduction
GO:0065009	0.948	regulation of molecular function
GO:0007165	0.927	signal transduction
GO:0051336	0.905	regulation of hydrolase activity
GO:0048519	0.840	negative regulation of biological process
GO:0043087	0.738	regulation of GTPase activity
GO:0035556	0.695	intracellular signal transduction
GO:0044092	0.411	negative regulation of molecular function
GO:0051346	0.397	negative regulation of hydrolase activity
GO:0034260	0.318	negative regulation of GTPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0005654	0.995	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]