StarFunc result for job id Q9P109

User Input

>input (453 residues)
MKIFKCYFKHTLQQKVFILFLTLWLLSLLKLLNVRRLFPQKDIYLVEYSLSTSPFVRNRY
THVKDEVRYEVNCSGIYEQEPLEIGKSLEIRRRDIIDLEDDDVVAMTSDCDIYQTLRGYA
QKLVSKEEKSFPIAYSLVVHKDAIMVERLIHAIYNQHNIYCIHYDRKAPDTFKVAMNNLA
KCFSNIFIASKLEAVEYAHISRLQADLNCLSDLLKSSIQWKYVINLCGQDFPLKSNFELV
SELKKLNGANMLETVKPPNSKLERFTYHHELRRVPYEYVKLPIRTNISKEAPPHNIQIFV
GSAYFVLSQAFVKYIFNNSIVQDFFAWSKDTYSPDEHFWATLIRVPGIPGEISRSAQDVS
DLQSKTRLVKWNYYEGFFYPSCTGSHLRSVCIYGAAELRWLIKDGHWFANKFDSKVDPIL
IKCLAEKLEEQQRDWITLPSEKLFMDRNLTTTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P109	1.000	1.000	5.088E-93	453	1.000	1.000	Q9P109.pdb.gz	GCNT4_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=GCNT4 PE=2 SV=1
2	AFDB:E9Q649	0.946	0.942	8.155E-82	455	0.817	0.813	E9Q649.pdb.gz	GCNT4_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Mus musculus OX=10090 GN=Gcnt4 PE=3 SV=1
3	AFDB:Q5JCT0	0.752	0.779	2.429E-46	437	0.382	0.396	Q5JCT0.pdb.gz	GCNT3_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Mus musculus OX=10090 GN=Gcnt3 PE=2 SV=2
4	AFDB:O95395	0.766	0.792	5.719E-46	438	0.389	0.402	O95395.pdb.gz	GCNT3_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=GCNT3 PE=2 SV=1
5	AFDB:Q09324	0.762	0.805	8.055E-46	428	0.389	0.411	Q09324.pdb.gz	GCNT1_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Gcnt1 PE=1 SV=2
6	AFDB:Q02742	0.760	0.803	3.553E-45	428	0.395	0.418	Q02742.pdb.gz	GCNT1_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=GCNT1 PE=1 SV=2
7	PDB:2gamC	0.733	0.883	2.879E-42	374	0.358	0.433	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
8	AFDB:Q6T5D9	0.703	0.793	4.809E-40	400	0.336	0.380	Q6T5D9.pdb.gz	Q6T5D9_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
9	AFDB:P97402	0.752	0.845	1.787E-39	401	0.336	0.379	P97402.pdb.gz	GCNT2_MOUSE N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Mus musculus OX=10090 GN=Gcnt2 PE=2 SV=2
10	AFDB:Q8N0V5	0.712	0.799	6.274E-39	402	0.331	0.373	Q8N0V5.pdb.gz	GNT2A_HUMAN N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Homo sapiens OX=9606 GN=GCNT2 PE=1 SV=1
11	AFDB:Q6T5E1	0.698	0.786	1.656E-38	400	0.331	0.375	Q6T5E1.pdb.gz	Q6T5E1_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
12	PDB:6fxrA	0.245	0.168	3.504E-5	700	0.051	0.033	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
13	PDB:7jhiC	0.356	0.463	1.162E-4	331	0.060	0.082	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
14	PDB:7x8kB	0.210	0.249	1.834E-4	367	0.062	0.076	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
15	PDB:1jv1A	0.230	0.216	4.319E-4	490	0.068	0.063	1jv1A.pdb.gz	Crystal structures of two human pyrophosphorylase isoforms in complexes with UDPGlc(Gal)NAc: role of the alternatively spliced insert in the enzyme oligomeric assembly and active site architecture.
16	PDB:3r2wC	0.225	0.226	4.841E-4	450	0.055	0.056	3r2wC.pdb.gz
17	PDB:7d72A	0.196	0.213	6.083E-4	407	0.042	0.047	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
18	PDB:2oi6B	0.252	0.252	1.353E-3	452	0.073	0.073	2oi6B.pdb.gz	Structure of the E. coli bifunctional GlmU acetyltransferase active site with substrates and products.
19	PDB:4y63A	0.244	0.349	1.516E-3	282	0.068	0.110	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
20	PDB:6qg2F	0.213	0.246	1.516E-3	375	0.046	0.056	6qg2F.pdb.gz	Structural basis for the inhibition of translation through eIF2 alpha phosphorylation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q649	0.0	749	455	0.817	0.813	GCNT4_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Mus musculus OX=10090 GN=Gcnt4 PE=3 SV=1
2	Q9P109	0.0	940	453	1.000	1.000	GCNT4_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=GCNT4 PE=2 SV=1
3	O95395	1.04e-109	333	438	0.397	0.411	GCNT3_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=GCNT3 PE=2 SV=1
4	Q64165	1.43e-109	332	428	0.362	0.383	Q64165_RAT Glucosaminyl (N-acetyl) transferase 1 OS=Rattus norvegicus OX=10116 GN=Gcnt1 PE=4 SV=1
5	Q02742	1.37e-108	329	428	0.371	0.393	GCNT1_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=GCNT1 PE=1 SV=2
6	Q8CH87	3.48e-108	328	437	0.373	0.387	GCNT3_RAT Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Gcnt3 PE=1 SV=1
7	Q09324	5.54e-108	328	428	0.369	0.390	GCNT1_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Gcnt1 PE=1 SV=2
8	Q5JCT0	2.87e-107	326	437	0.377	0.391	GCNT3_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Mus musculus OX=10090 GN=Gcnt3 PE=2 SV=2
9	Q6T5D9	3.84e-92	286	400	0.325	0.367	Q6T5D9_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
10	P97402	6.67e-91	283	401	0.349	0.394	GCNT2_MOUSE N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Mus musculus OX=10090 GN=Gcnt2 PE=2 SV=2
11	Q6T5E1	1.06e-90	283	400	0.318	0.360	Q6T5E1_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
12	Q8N0V5	3.65e-90	281	402	0.311	0.351	GNT2A_HUMAN N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Homo sapiens OX=9606 GN=GCNT2 PE=1 SV=1
13	Q6T5E0	8.42e-89	278	400	0.322	0.365	Q6T5E0_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=4 SV=1
14	Q7KVA1	2.73e-16	84.0	876	0.152	0.079	XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster OX=7227 GN=oxt PE=2 SV=1
15	Q9H1B5	2.73e-15	80.9	865	0.179	0.094	XYLT2_HUMAN Xylosyltransferase 2 OS=Homo sapiens OX=9606 GN=XYLT2 PE=1 SV=2
16	Q9EPL0	1.25e-14	78.6	865	0.174	0.091	XYLT2_MOUSE Xylosyltransferase 2 OS=Mus musculus OX=10090 GN=Xylt2 PE=2 SV=3
17	D3J0E7	1.16e-13	75.9	919	0.157	0.077	D3J0E7_DANRE protein xylosyltransferase OS=Danio rerio OX=7955 GN=xylt1 PE=2 SV=1
18	Q9EPI1	8.74e-12	69.7	821	0.172	0.095	XYLT1_RAT Xylosyltransferase 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Xylt1 PE=2 SV=1
19	Q86Y38	1.76e-11	68.9	959	0.188	0.089	XYLT1_HUMAN Xylosyltransferase 1 OS=Homo sapiens OX=9606 GN=XYLT1 PE=1 SV=1
20	Q811B1	2.11e-11	68.6	953	0.141	0.067	XYLT1_MOUSE Xylosyltransferase 1 OS=Mus musculus OX=10090 GN=Xylt1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02485 Branch	4.5e-47	172.2	Core-2/I-Branching enzyme
2	PF16216 GxGYxYP_N	1.7e+02	13.7	GxGYxY sequence motif in domain of unknown function N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317027

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000389176	0.957	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
2	9606.ENSP00000414350	0.952	Mucin-20
3	9606.ENSP00000321874	0.950	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3
4	9606.ENSP00000304364	0.948	C1GALT1-specific chaperone 1
5	9606.ENSP00000428540	0.939	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1
6	9606.ENSP00000406861	0.929	Mucin-6
7	9606.ENSP00000368771	0.926	Mucin-3A
8	9606.ENSP00000436812	0.926	Mucin-5B
9	9606.ENSP00000485659	0.923	Mucin-5AC
10	9606.ENSP00000377257	0.921	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
11	9606.ENSP00000485028	0.917	Mucin-13
12	9606.ENSP00000484824	0.916	Mucin-1
13	9606.ENSP00000417498	0.915	Mucin-4
14	9606.ENSP00000416753	0.913	Mucin-15
15	9606.ENSP00000365473	0.911	Mucin-21
16	9606.ENSP00000407422	0.911	Mucin-7
17	9606.ENSP00000381008	0.910	Mucin-16
18	9606.ENSP00000302716	0.907	Mucin-17
19	9606.ENSP00000441929	0.903	Mucin-12
20	9606.ENSP00000311364	0.900	Mucin-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140103	1.000	catalytic activity, acting on a glycoprotein
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0003829	0.966	beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity
GO:0005488	0.749	binding
GO:0008109	0.736	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity
GO:0005515	0.441	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.995	metabolic process
GO:0006493	0.985	protein O-linked glycosylation
GO:0005975	0.775	carbohydrate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0098588	0.996	bounding membrane of organelle
GO:0000139	0.988	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:18705	0.966	a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + UDP-N-acetyl-alpha-D-glucosamine = a beta-D-galactosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl derivative + H(+) + UDP
EC:2.4.1.102	0.966	acetylglucosaminyltransferase.
RHEA:17413	0.736	a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-N-acetyl-alpha-D-glucosamine = an N-acetyl-beta-D-glucosaminyl-(1->6)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP
EC:2.4.1.150	0.736	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase.

[back to server]