StarFunc result for job id Q9P1A2

User Input

>input (415 residues)
MAEIPLYFVDLQDDLDDYGFEDYGTDCDNMRVTAFLDIPGQDNLPPLTRLEKYAFSENTF
NRQIIARGLLDIFRDFGNNEEDFLTVMEIVVRLSEDAEPTVRTELMEQIPPIAIFLQENR
SNFPVVLSEYLIPIVVRYLTDPNNQIICKMASMLSKSTVERLLLPRFCELCGDRKLFQVR
KVCAANFGDICHAVGQEATEKFLIPKFFELCSDAVWGMRKACAECFTAVSHSSSPGVRRT
QLFPLFIRLVSDPCRWVHQAAFQSLGPFTSTFANPSRAGLYLREDGALSIWPLTQDLDSG
FASGSPAPSSGGNTSPASLTRSAKPVRSEPELPVEGTSAKTSDCPHSSSSSDGPAESPVE
SCVSAGAEWTRVSPETSACSKLSDMNDLPISSYPGSDSWACPGNTEDVFSHFLYW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P1A2	1.000	1.000	4.064E-53	415	1.000	1.000	Q9P1A2.pdb.gz	PP4RL_HUMAN Putative serine/threonine-protein phosphatase 4 regulatory subunit 1-like OS=Homo sapiens OX=9606 GN=PPP4R1L PE=5 SV=3
2	AFDB:P30154	0.381	0.277	8.452E-7	601	0.133	0.092	P30154.pdb.gz	2AAB_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens OX=9606 GN=PPP2R1B PE=1 SV=3
3	AFDB:Q9T041	0.390	0.208	1.845E-6	864	0.130	0.062	Q9T041.pdb.gz	TOR1_ARATH Microtubule-associated protein TORTIFOLIA1 OS=Arabidopsis thaliana OX=3702 GN=TOR1 PE=1 SV=2
4	AFDB:Q54QR9	0.353	0.265	4.028E-6	584	0.104	0.074	Q54QR9.pdb.gz	2AAA_DICDI Protein phosphatase 2A scaffold subunit OS=Dictyostelium discoideum OX=44689 GN=pppA PE=1 SV=1
5	AFDB:Q5B1Q9	0.383	0.195	6.490E-6	891	0.154	0.072	Q5B1Q9.pdb.gz	Q5B1Q9_EMENI Dis1/XMAP215 protein AlpA (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=alpA PE=4 SV=1
6	PDB:1b3uA	0.396	0.292	1.437E-5	588	0.128	0.090	1b3uA.pdb.gz
7	PDB:7k36A	0.462	0.352	4.070E-5	554	0.106	0.079	7k36A.pdb.gz	Cryo-EM structure of the Hippo signaling integrator human STRIPAK.
8	AFDB:Q9VS24	0.244	0.135	1.088E-4	994	0.157	0.065	Q9VS24.pdb.gz	MELT_DROME Protein melted OS=Drosophila melanogaster OX=7227 GN=melt PE=1 SV=2
9	AFDB:Q8RWY6	0.362	0.132	2.178E-4	1439	0.154	0.044	Q8RWY6.pdb.gz	CLASP_ARATH CLIP-associated protein OS=Arabidopsis thaliana OX=3702 GN=CLASP PE=1 SV=1
10	AFDB:Q5B4Z3	0.191	0.095	2.950E-4	1346	0.173	0.053	Q5B4Z3.pdb.gz	SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sepH PE=3 SV=2
11	PDB:5tbkA	0.337	0.336	3.409E-4	417	0.080	0.079	5tbkA.pdb.gz
12	PDB:2q5dB	0.410	0.222	3.882E-4	845	0.096	0.047	2q5dB.pdb.gz	Molecular Basis for the Recognition of Snurportin 1 by Importin {beta}.
13	PDB:3w3uA	0.319	0.152	3.882E-4	1030	0.104	0.042	3w3uA.pdb.gz
14	PDB:4jlqA	0.379	0.206	5.493E-4	840	0.104	0.051	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
15	PDB:6kbnC	0.290	0.250	5.493E-4	504	0.092	0.075	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
16	PDB:3tpoA	0.301	0.288	5.736E-4	438	0.094	0.089	3tpoA.pdb.gz
17	PDB:6xu2A	0.331	0.158	7.125E-4	1091	0.116	0.044	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
18	AFDB:F4JC31	0.348	0.187	7.999E-4	886	0.137	0.064	F4JC31.pdb.gz	F4JC31_ARATH Binding protein OS=Arabidopsis thaliana OX=3702 GN=SMEK1 PE=1 SV=1
19	PDB:7sn8D	0.195	0.201	9.243E-4	399	0.106	0.110	7sn8D.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
20	AFDB:Q94FN2	0.387	0.095	9.515E-4	1978	0.128	0.027	Q94FN2.pdb.gz	MOR1_ARATH Protein MOR1 OS=Arabidopsis thaliana OX=3702 GN=MOR1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P1A2	0.0	855	415	1.000	1.000	PP4RL_HUMAN Putative serine/threonine-protein phosphatase 4 regulatory subunit 1-like OS=Homo sapiens OX=9606 GN=PPP4R1L PE=5 SV=3
2	Q8TF05	1.70e-106	337	950	0.407	0.178	PP4R1_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP4R1 PE=1 SV=1
3	F1MRS1	1.78e-99	318	893	0.400	0.186	F1MRS1_BOVIN Protein phosphatase 4 regulatory subunit 1 OS=Bos taurus OX=9913 GN=PPP4R1 PE=1 SV=3
4	G5ECH5	9.69e-23	103	1562	0.125	0.033	PP4R1_CAEEL Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Caenorhabditis elegans OX=6239 GN=ppfr-1 PE=1 SV=1
5	Q5ADN1	9.24e-10	62.8	643	0.123	0.079	Q5ADN1_CANAL Protein phosphatase 2A structural subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TPD3 PE=4 SV=1
6	Q385S3	2.29e-04	45.8	786	0.065	0.034	Q385S3_TRYB2 Serine/threonine-protein phosphatase 4 regulatory subunit 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2560 PE=4 SV=1
7	Q09543	5.28e-04	44.7	590	0.147	0.103	2AAA_CAEEL Probable serine/threonine-protein phosphatase PP2A regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=paa-1 PE=1 SV=2
8	P36179	5.76e-04	44.7	591	0.084	0.059	2AAA_DROME Serine/threonine-protein phosphatase PP2A 65 kDa regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pp2A-29B PE=1 SV=4
9	Q32PI5	0.001	43.1	589	0.080	0.056	2AAA_BOVIN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Bos taurus OX=9913 GN=PPP2R1A PE=1 SV=1
10	Q76MZ3	0.001	43.1	589	0.080	0.056	2AAA_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Mus musculus OX=10090 GN=Ppp2r1a PE=1 SV=3
11	A0A1D8PPK3	0.002	42.7	1537	0.060	0.016	A0A1D8PPK3_CANAL non-specific serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VPS15 PE=4 SV=1
12	A8K7B7	0.004	42.0	589	0.077	0.054	A8K7B7_HUMAN Protein phosphatase 2 (Formerly 2A), regulatory subunit A (PR 65), alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=1
13	P30153	0.004	42.0	589	0.077	0.054	2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4
14	P30154	0.005	41.6	601	0.080	0.055	2AAB_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens OX=9606 GN=PPP2R1B PE=1 SV=3
15	Q9M0E5	0.010	40.8	1494	0.096	0.027	VPS15_ARATH Serine/threonine-protein kinase VPS15 OS=Arabidopsis thaliana OX=3702 GN=VPS15 PE=1 SV=1
16	Q9UT08	0.016	39.7	590	0.092	0.064	2AAA_SCHPO Protein phosphatase PP2A regulatory subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=paa1 PE=1 SV=1
17	Q7TNP2	0.017	39.7	601	0.080	0.055	2AAB_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Mus musculus OX=10090 GN=Ppp2r1b PE=1 SV=2
18	Q38950	0.024	39.3	587	0.065	0.046	2AAB_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA2 PE=1 SV=2
19	E9PS17	0.027	39.3	775	0.111	0.059	E9PS17_HUMAN SCY1 like pseudokinase 1 OS=Homo sapiens OX=9606 GN=SCYL1 PE=1 SV=1
20	E9PPN3	0.028	39.3	665	0.111	0.069	E9PPN3_HUMAN SCY1 like pseudokinase 1 OS=Homo sapiens OX=9606 GN=SCYL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18912 DZR_2	4.5e+02	12.2	Double zinc ribbon domain
2	PF02985 HEAT	1.1e-11	54.9	HEAT repeat
3	PF13646 HEAT_2	0.037	25.7	HEAT repeats

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000023514

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000053618	0.977	Serine/threonine-protein phosphatase
2	9598.ENSPTRP00000029492	0.844	Protein phosphatase 2, catalytic subunit, alpha isozyme
3	9598.ENSPTRP00000048808	0.840	Serine/threonine-protein phosphatase 2A activator
4	9598.ENSPTRP00000045835	0.724	Protein phosphatase methylesterase 1
5	9598.ENSPTRP00000056165	0.704	Methylates the carboxyl group of the C-terminal leucine residue of protein phosphatase 2A catalytic subunits to form alpha- leucine ester residues
6	9598.ENSPTRP00000023482	0.703	Chromosome 20 open reading frame 43
7	9598.ENSPTRP00000005392	0.688	Protein phosphatase 2, regulatory subunit B, delta
8	9598.ENSPTRP00000027362	0.688	Protein phosphatase 2, regulatory subunit B, gamma
9	9598.ENSPTRP00000053217	0.688	Protein phosphatase 2, regulatory subunit B, alpha
10	9598.ENSPTRP00000057740	0.688	Protein phosphatase 2, regulatory subunit B, beta
11	9598.ENSPTRP00000044468	0.679	Protein phosphatase 4, regulatory subunit 2
12	9598.ENSPTRP00000023517	0.677	RAB22A, member RAS oncogene family
13	9598.ENSPTRP00000010629	0.669	Pan troglodytes protein phosphatase 2, regulatory subunit B'', gamma (PPP2R3C), mRNA
14	9598.ENSPTRP00000026587	0.669	Protein phosphatase 2, regulatory subunit B'', alpha
15	9598.ENSPTRP00000023478	0.668	Pan troglodytes cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), mRNA
16	9598.ENSPTRP00000051570	0.654	Uncharacterized protein
17	9598.ENSPTRP00000003300	0.623	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit
18	9598.ENSPTRP00000006640	0.623	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit
19	9598.ENSPTRP00000010895	0.623	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit
20	9598.ENSPTRP00000011475	0.623	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.963	biological regulation
GO:0050789	0.903	regulation of biological process
GO:0050794	0.856	regulation of cellular process
GO:0009987	0.818	cellular process
GO:0019222	0.452	regulation of metabolic process
GO:0031323	0.402	regulation of cellular metabolic process
GO:0048519	0.394	negative regulation of biological process
GO:0080090	0.381	regulation of primary metabolic process
GO:0051171	0.356	regulation of nitrogen compound metabolic process
GO:0060255	0.349	regulation of macromolecule metabolic process
GO:0051174	0.325	regulation of phosphorus metabolic process
GO:0065009	0.300	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.946	cytosol
GO:0032991	0.933	protein-containing complex
GO:1902494	0.891	catalytic complex
GO:0043229	0.865	intracellular organelle
GO:0008287	0.849	protein serine/threonine phosphatase complex
GO:0043227	0.406	membrane-bounded organelle
GO:0043231	0.314	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]