StarFunc result for job id Q9P1A6

User Input

>input (1054 residues)
MGTAQVLPGILQKHCCILPDRNTESQCTLCGEPEEEEAGDLVQPGISFPGPAEEDLDPQY
SWSPTQHFNEERYSPAPRSMKGLSGSRTQPPLCSGHTCGLAPPEDCEHLHHGPDARPPYL
LSPADSCPGGRHRCSPRSSVHSECVMMPVVLGDHVSSSTFPRMHYSSHYDTRDDCAVAHA
GAKINRIPANLLDQFEKQLPLHRDGFHTLQYQRTSAAAEQRSESPGRIRHLVHSVQKLFT
KSHSLEGSSKSNANGTKADGRADDHHHAHHAKHSKRSKSKERKPEGKPRPGMSSWWSSDD
NLDSDSTYRTPSVLNRHHLGPVAHCYPDALQSPFGDLSLKTSKSNNDVKCSACEGLALTP
DAKYLKRSSWSTLTVSQAKEAYRKSSLNLDKPLLHQDAKPALRPCHYLQVPQDEWGGYPT
GGKDEEIPCRRMRSGSYIKAMGDEESGESDSSPKTSPKSAILPEPLLKSIGQRPLGEHQT
QTYLQAASDVPVGHSLDPAANYNSPKFRSRNQSYMRAVSTLSQASCVSQVSEAEINGQFE
SVCESVFSEVESQAMDALDLPGCFRTRSHSYLRAIQAGYSQDDECIPMMTPSDITSTIRS
TAAVSYTNYKKTPPPVPPRTTSKPLISVTAQSSTESTQDAYQDSRAQRMSPWPQDSRGLY
NSTDSLDSNKAMNLALETAAAQRHLPESQSSSVRTSDKAILVSKAEELLKSRCSSIGIQD
SEFPEHQPYPRSDVETATDSDTESRGLREYHSVGVQVEDEKRHGRFKRSNSVTAAVQADL
ELEGFPGHITTEDKGLQFGSSFQRHSEPSTPTQYSAVRTVRTQGLFSYREDYRTQVDTST
LPPPDPWLEPAIDTVETGRMSPCRRDGSWFLKLLHAETKRMEGWCKEMEREAEENDLSEE
ILGKIRSAVGSAQLLMSQKFQQFYWLCQQNMDPSAMPRPTSQDLAGYWDMLQLSIEDVSM
KFDELQRLRLNDWKMMESPERKEERKVPPPIPKKPPKGKFPITREKSLDLPDRQRQEARR
RLMAAKRAASFRQNSASERADSIEIYIPEAQTRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97837	0.398	0.397	0.000	1059	0.896	0.891	P97837.pdb.gz	DLGP2_RAT Disks large-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Dlgap2 PE=1 SV=3
2	AFDB:Q9P1A6	1.000	1.000	0.000	1054	1.000	1.000	Q9P1A6.pdb.gz	DLGP2_HUMAN Disks large-associated protein 2 OS=Homo sapiens OX=9606 GN=DLGAP2 PE=1 SV=4
3	AFDB:O95886	0.220	0.233	2.059E-59	979	0.452	0.486	O95886.pdb.gz	DLGP3_HUMAN Disks large-associated protein 3 OS=Homo sapiens OX=9606 GN=DLGAP3 PE=1 SV=3
4	AFDB:B1AZP2	0.182	0.189	1.940E-48	992	0.405	0.430	B1AZP2.pdb.gz	DLGP4_MOUSE Disks large-associated protein 4 OS=Mus musculus OX=10090 GN=Dlgap4 PE=1 SV=1
5	PDB:4r0yB	0.103	0.228	1.026E-11	473	0.076	0.169	4r0yB.pdb.gz
6	AFDB:P29617	0.047	0.036	2.807E-3	1703	0.149	0.092	P29617.pdb.gz	PROS_DROME Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3
7	AFDB:Q569L8	0.048	0.040	2.807E-3	1344	0.155	0.121	Q569L8.pdb.gz	CENPJ_MOUSE Centromere protein J OS=Mus musculus OX=10090 GN=Cenpj PE=2 SV=2
8	AFDB:A0A1D8PGE6	0.047	0.058	4.071E-3	838	0.119	0.149	A0A1D8PGE6.pdb.gz	A0A1D8PGE6_CANAL Hap42p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HAP42 PE=4 SV=1
9	AFDB:Q8IWB4	0.067	0.055	4.331E-3	1347	0.172	0.134	Q8IWB4.pdb.gz	S31A7_HUMAN Spermatogenesis-associated protein 31A7 OS=Homo sapiens OX=9606 GN=SPATA31A7 PE=1 SV=4
10	AFDB:Q9V4P1	0.058	0.052	5.215E-3	1239	0.113	0.096	Q9V4P1.pdb.gz	ANLN_DROME Anillin OS=Drosophila melanogaster OX=7227 GN=scra PE=1 SV=3
11	AFDB:P0CY24	0.039	0.035	5.548E-3	1228	0.136	0.116	P0CY24.pdb.gz	STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CST20 PE=3 SV=1
12	PDB:2b5uA	0.060	0.121	5.206E-1	470	0.011	0.026	2b5uA.pdb.gz
13	PDB:7n6g3I	0.047	0.093	6.669E-1	401	0.022	0.057	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
14	PDB:1yviA	0.053	0.322	7.095E-1	140	0.012	0.093	1yviA.pdb.gz
15	PDB:7nsuD	0.063	0.141	7.095E-1	420	0.012	0.031	7nsuD.pdb.gz
16	PDB:1y8pA	0.059	0.122	8.544E-1	381	0.020	0.055	1y8pA.pdb.gz	Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
17	PDB:1ggqA	0.058	0.222	1.029	162	0.008	0.049	1ggqA.pdb.gz
18	PDB:1wn0C	0.055	0.352	1.029	138	0.016	0.123	1wn0C.pdb.gz
19	PDB:7yqcA	0.088	0.360	1.029	198	0.015	0.081	7yqcA.pdb.gz
20	PDB:6ybwz	0.042	0.152	1.239	160	0.021	0.138	6ybwz.pdb.gz	Structure of a human 48Stranslational initiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AZP2	0.0	572	992	0.416	0.442	DLGP4_MOUSE Disks large-associated protein 4 OS=Mus musculus OX=10090 GN=Dlgap4 PE=1 SV=1
2	O14490	0.0	849	977	0.514	0.555	DLGP1_HUMAN Disks large-associated protein 1 OS=Homo sapiens OX=9606 GN=DLGAP1 PE=1 SV=1
3	O95886	0.0	739	979	0.459	0.494	DLGP3_HUMAN Disks large-associated protein 3 OS=Homo sapiens OX=9606 GN=DLGAP3 PE=1 SV=3
4	P97836	0.0	832	992	0.515	0.547	DLGP1_RAT Disks large-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Dlgap1 PE=1 SV=1
5	P97837	0.0	1856	1059	0.896	0.891	DLGP2_RAT Disks large-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Dlgap2 PE=1 SV=3
6	P97838	0.0	714	977	0.449	0.484	DLGP3_RAT Disks large-associated protein 3 OS=Rattus norvegicus OX=10116 GN=Dlgap3 PE=1 SV=2
7	P97839	0.0	563	992	0.411	0.436	DLGP4_RAT Disks large-associated protein 4 OS=Rattus norvegicus OX=10116 GN=Dlgap4 PE=1 SV=1
8	Q6PFD5	0.0	734	977	0.456	0.492	DLGP3_MOUSE Disks large-associated protein 3 OS=Mus musculus OX=10090 GN=Dlgap3 PE=1 SV=1
9	Q8BJ42	0.0	1857	1059	0.896	0.891	DLGP2_MOUSE Disks large-associated protein 2 OS=Mus musculus OX=10090 GN=Dlgap2 PE=1 SV=2
10	Q9D415	0.0	830	992	0.513	0.545	DLGP1_MOUSE Disks large-associated protein 1 OS=Mus musculus OX=10090 GN=Dlgap1 PE=1 SV=3
11	Q9P1A6	0.0	2185	1054	1.000	1.000	DLGP2_HUMAN Disks large-associated protein 2 OS=Homo sapiens OX=9606 GN=DLGAP2 PE=1 SV=4
12	Q9Y2H0	0.0	586	992	0.427	0.454	DLGP4_HUMAN Disks large-associated protein 4 OS=Homo sapiens OX=9606 GN=DLGAP4 PE=1 SV=3
13	Q6IS01	1.16e-162	492	543	0.271	0.527	Q6IS01_HUMAN DLG associated protein 1 OS=Homo sapiens OX=9606 GN=DLGAP1 PE=1 SV=1
14	Q15398	3.96e-14	79.3	846	0.055	0.069	DLGP5_HUMAN Disks large-associated protein 5 OS=Homo sapiens OX=9606 GN=DLGAP5 PE=1 SV=2
15	Q7K3L1	4.80e-10	66.2	921	0.038	0.043	MARS_DROME Guanylate kinase-associated protein mars OS=Drosophila melanogaster OX=7227 GN=mars PE=1 SV=1
16	B7FAT5	3.9	33.5	279	0.019	0.072	B7FAT5_MOUSE Dynein, axonemal, heavy chain 9 (Fragment) OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
17	Q9BZW2	4.2	33.9	595	0.037	0.066	S13A1_HUMAN Solute carrier family 13 member 1 OS=Homo sapiens OX=9606 GN=SLC13A1 PE=1 SV=1
18	C0LGQ7	6.3	33.1	898	0.036	0.042	Y4245_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20450 OS=Arabidopsis thaliana OX=3702 GN=At4g20450 PE=1 SV=1
19	Q76P24	6.4	33.5	3095	0.023	0.008	HD_DICDI HD protein homolog OS=Dictyostelium discoideum OX=44689 GN=htt PE=3 SV=1
20	O76329	6.6	33.1	1738	0.019	0.012	ACTNB_DICDI Interaptin OS=Dictyostelium discoideum OX=44689 GN=abpD PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03359 GKAP	1.6e-160	545.9	Guanylate-kinase-associated protein (GKAP) protein
2	PF01620 Pollen_allerg_2	2.9e+02	13.1	Ribonuclease (pollen allergen)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003807578.2

Rank	PPI partner	STRING score	Description
1	9597.XP_008959821.1	0.982	SH3 and multiple ankyrin repeat domains 3
2	9597.XP_008952465.1	0.917	SH3 and multiple ankyrin repeat domains 2
3	9597.XP_003810153.1	0.910	Belongs to the MAGUK family.
4	9597.XP_008964498.1	0.860	SH3 and multiple ankyrin repeat domains 1
5	9597.XP_008958875.1	0.764	ras/Rap GTPase-activating protein SynGAP isoform X1
6	9597.XP_008973757.1	0.753	Discs large MAGUK scaffold protein 2
7	9597.XP_008974516.1	0.720	Neurexin 1
8	9597.XP_003812611.1	0.711	DLG associated protein 3
9	9597.XP_003819223.1	0.700	Belongs to the peptidase S9B family.
10	9597.XP_008971813.1	0.699	Discs large MAGUK scaffold protein 3
11	9597.XP_008951849.1	0.693	Belongs to the MAGUK family.
12	9597.XP_003820194.1	0.685	Neuroligin 3
13	9597.XP_003804930.1	0.684	Neuroligin-4, X-linked
14	9597.XP_008955566.1	0.684	Neuroligin-1 isoform X1
15	9597.XP_003846183.2	0.673	Protein phosphatase 1 regulatory subunit 9B
16	9597.XP_003816404.1	0.666	Belongs to the peptidase S9B family.
17	9597.XP_008957936.1	0.665	Glutamate rich 1
18	9597.XP_008960391.1	0.660	SRC kinase signaling inhibitor 1
19	9597.XP_003819618.1	0.658	Patched domain-containing protein 1
20	9597.XP_003822912.1	0.650	RNA guanylyltransferase and 5'-phosphatase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0009987	0.959	cellular process
GO:0010646	0.816	regulation of cell communication
GO:0023051	0.793	regulation of signaling
GO:0099177	0.721	regulation of trans-synaptic signaling
GO:0023052	0.550	signaling
GO:0048583	0.517	regulation of response to stimulus
GO:0065009	0.391	regulation of molecular function
GO:0007154	0.383	cell communication
GO:0009966	0.356	regulation of signal transduction
GO:0051239	0.328	regulation of multicellular organismal process
GO:0099601	0.314	regulation of neurotransmitter receptor activity
GO:0031644	0.312	regulation of nervous system process
GO:0050804	0.308	modulation of chemical synaptic transmission

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.994	organelle
GO:0005622	0.986	intracellular anatomical structure
GO:0030054	0.982	cell junction
GO:0043229	0.980	intracellular organelle
GO:0045202	0.951	synapse
GO:0098794	0.768	postsynapse
GO:0005737	0.751	cytoplasm
GO:0043232	0.685	intracellular non-membrane-bounded organelle
GO:0099572	0.598	postsynaptic specialization
GO:0042995	0.487	cell projection
GO:0120025	0.481	plasma membrane bounded cell projection
GO:0043231	0.393	intracellular membrane-bounded organelle
GO:0043005	0.382	neuron projection
GO:0036477	0.376	somatodendritic compartment
GO:0098984	0.361	neuron to neuron synapse
GO:0005829	0.338	cytosol
GO:0098978	0.313	glutamatergic synapse
GO:0030425	0.304	dendrite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]