StarFunc result for job id Q9P1Q0

User Input

>input (977 residues)
MASSHSSSPVPQGSSSDVFFKIEVDPSKHIRPVPSLPDVCPKEPTGDSHSLYVAPSLVTD
QHRWTVYHSKVNLPAALNDPRLAKRESDFFTKTWGLDFVDTEVIPSFYLPQISKEHFTVY
QQEISQREKIHERCKNICPPKDTFERTLLHTHDKSRTDLEQVPKIFMKPDFALDDSLTFN
SVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVNIAHQISLRSEAFFHAMTSQHE
LQDYLRKTSQAVKMLRDKIAQIDKVMCEGSLHILRLALTRNNCVKVYNKLKLMATVHQTQ
PTVQVLLSTSEFVGALDLIATTQEVLQQELQGIHSFRHLGSQLCELEKLIDKMMIAEFST
YSHSDLNRPLEDDCQVLEEERLISLVFGLLKQRKLNFLEIYGEKMVITAKNIIKQCVINK
VSQTEEIDTDVVVKLADQMRMLNFPQWFDLLKDIFSKFTIFLQRVKATLNIIHSVVLSVL
DKNQRTRELEEISQQKNAAKDNSLDTEVAYLIHEGMFISDAFGEGELTPIAVDTTSQRNA
SPNSEPCSSDSVSEPECTTDSSSSKEHTSSSAIPGGVDIMVSEDMKLTDSELGKLANNIQ
ELLYSASDICHDRAVKFLMSRAKDGFLEKLNSMEFITLSRLMETFILDTEQICGRKSTSL
LGALQSQAIKFVNRFHEERKTKLSLLLDNERWKQADVPAEFQDLVDSLSDGKIALPEKKS
GATEERKPAEVLIVEGQQYAVVGTVLLLIRIILEYCQCVDNIPSVTTDMLTRLSDLLKYF
NSRSCQLVLGAGALQVVGLKTITTKNLALSSRCLQLIVHYIPVIRAHFEARLPPKQYSML
RHFDHITKDYHDHIAEISAKLVAIMDSLFDKLLSKYEVKAPVPSACFRNICKQMTKMHEA
IFDLLPEEQTQMLFLRINASYKLHLKKQLSHLNVINDGGPQNGLVTADVAFYTGNLQALK
GLKDLDLNMAEIWEQKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5SPW0	0.889	0.889	0.000	977	0.926	0.926	Q5SPW0.pdb.gz	VPS54_MOUSE Vacuolar protein sorting-associated protein 54 OS=Mus musculus OX=10090 GN=Vps54 PE=1 SV=1
2	AFDB:Q9VLC0	0.536	0.556	7.731E-50	940	0.329	0.341	Q9VLC0.pdb.gz	VPS54_DROME Vacuolar protein sorting-associated protein 54 OS=Drosophila melanogaster OX=7227 GN=scat PE=1 SV=1
3	AFDB:Q22639	0.584	0.543	7.698E-46	1058	0.258	0.238	Q22639.pdb.gz	VPS54_CAEEL Vacuolar protein sorting-associated protein 54 OS=Caenorhabditis elegans OX=6239 GN=vps-54 PE=1 SV=2
4	AFDB:F4JT76	0.512	0.486	7.543E-37	1034	0.257	0.243	F4JT76.pdb.gz	VPS54_ARATH Vacuolar protein sorting-associated protein 54, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=VPS54 PE=1 SV=1
5	AFDB:O14093	0.478	0.490	7.054E-24	949	0.160	0.164	O14093.pdb.gz	VPS54_SCHPO Vacuolar protein sorting-associated protein 54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps54 PE=1 SV=1
6	AFDB:Q38AB2	0.464	0.420	9.635E-18	1089	0.145	0.130	Q38AB2.pdb.gz	Q38AB2_TRYB2 Vacuolar protein sorting-associated protein 54 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1940 PE=3 SV=1
7	AFDB:A1ZAY8	0.386	0.389	3.221E-15	966	0.129	0.130	A1ZAY8.pdb.gz	A1ZAY8_DROME FI23003p1 OS=Drosophila melanogaster OX=7227 GN=Vps50 PE=2 SV=1
8	AFDB:F1LSG8	0.415	0.419	6.087E-15	964	0.118	0.119	F1LSG8.pdb.gz	VPS50_RAT Syndetin OS=Rattus norvegicus OX=10116 GN=Vps50 PE=1 SV=1
9	AFDB:Q8RXC2	0.389	0.351	6.351E-15	1124	0.137	0.119	Q8RXC2.pdb.gz	Q8RXC2_ARATH At2g27890 OS=Arabidopsis thaliana OX=3702 GN=At2g27890 PE=1 SV=1
10	AFDB:O35382	0.355	0.356	2.594E-11	975	0.099	0.099	O35382.pdb.gz	EXOC4_MOUSE Exocyst complex component 4 OS=Mus musculus OX=10090 GN=Exoc4 PE=1 SV=2
11	PDB:3fhnA	0.199	0.266	1.629E-4	673	0.081	0.117	3fhnA.pdb.gz
12	PDB:7qpgW	0.203	0.245	2.192E-4	779	0.095	0.119	7qpgW.pdb.gz
13	PDB:2b7mB	0.272	0.429	6.069E-4	523	0.073	0.136	2b7mB.pdb.gz
14	PDB:3gjxA	0.079	0.076	1.908E-3	1041	0.104	0.098	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
15	PDB:7cunG	0.082	0.086	2.916E-3	895	0.079	0.086	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
16	PDB:5yfpC	0.217	0.254	3.312E-3	794	0.083	0.102	5yfpC.pdb.gz
17	PDB:7useB	0.130	0.120	3.312E-3	1099	0.089	0.079	7useB.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
18	PDB:4bujB	0.093	0.079	3.925E-3	1367	0.091	0.065	4bujB.pdb.gz
19	PDB:7qpgR	0.077	0.046	5.511E-3	2208	0.105	0.047	7qpgR.pdb.gz
20	PDB:7blnA	0.094	0.106	5.749E-3	769	0.099	0.126	7blnA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5SPW0	0.0	1879	977	0.926	0.926	VPS54_MOUSE Vacuolar protein sorting-associated protein 54 OS=Mus musculus OX=10090 GN=Vps54 PE=1 SV=1
2	Q9JMK8	0.0	1828	965	0.900	0.911	VPS54_RAT Vacuolar protein sorting-associated protein 54 OS=Rattus norvegicus OX=10116 GN=Vps54 PE=2 SV=1
3	Q9P1Q0	0.0	2023	977	1.000	1.000	VPS54_HUMAN Vacuolar protein sorting-associated protein 54 OS=Homo sapiens OX=9606 GN=VPS54 PE=1 SV=2
4	Q9VLC0	8.22e-85	295	940	0.169	0.176	VPS54_DROME Vacuolar protein sorting-associated protein 54 OS=Drosophila melanogaster OX=7227 GN=scat PE=1 SV=1
5	D7SFN0	1.66e-58	217	749	0.106	0.139	D7SFN0_CAEEL Vacuolar protein sorting-associated protein 54 OS=Caenorhabditis elegans OX=6239 GN=vps-54 PE=1 SV=1
6	Q22639	1.68e-57	217	1058	0.106	0.098	VPS54_CAEEL Vacuolar protein sorting-associated protein 54 OS=Caenorhabditis elegans OX=6239 GN=vps-54 PE=1 SV=2
7	F4JT76	1.30e-28	126	1034	0.121	0.114	VPS54_ARATH Vacuolar protein sorting-associated protein 54, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=VPS54 PE=1 SV=1
8	O14093	2.18e-06	54.3	949	0.043	0.044	VPS54_SCHPO Vacuolar protein sorting-associated protein 54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps54 PE=1 SV=1
9	Q38AB2	1.36e-05	51.6	1089	0.037	0.033	Q38AB2_TRYB2 Vacuolar protein sorting-associated protein 54 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1940 PE=3 SV=1
10	Q12071	1.43e-04	48.1	889	0.061	0.067	VPS54_YEAST Vacuolar protein sorting-associated protein 54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS54 PE=1 SV=1
11	Q96JG6	0.006	42.7	964	0.020	0.021	VPS50_HUMAN Syndetin OS=Homo sapiens OX=9606 GN=VPS50 PE=1 SV=3
12	F1LSG8	0.044	40.0	964	0.021	0.022	VPS50_RAT Syndetin OS=Rattus norvegicus OX=10116 GN=Vps50 PE=1 SV=1
13	A1ZAY8	0.048	40.0	966	0.017	0.018	A1ZAY8_DROME FI23003p1 OS=Drosophila melanogaster OX=7227 GN=Vps50 PE=2 SV=1
14	Q960B0	0.048	40.0	966	0.017	0.018	Q960B0_DROME SD10481p OS=Drosophila melanogaster OX=7227 GN=Vps50 PE=2 SV=1
15	Q8CI71	0.069	39.7	964	0.020	0.021	VPS50_MOUSE Syndetin OS=Mus musculus OX=10090 GN=Vps50 PE=1 SV=2
16	C8VIR1	0.66	36.6	1207	0.035	0.028	C8VIR1_EMENI Calmodulin-binding coil-coil protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03062 PE=4 SV=1
17	Q8IZF0	0.78	36.2	1738	0.026	0.014	NALCN_HUMAN Sodium leak channel NALCN OS=Homo sapiens OX=9606 GN=NALCN PE=1 SV=1
18	Q8BXR5	0.95	35.8	1738	0.026	0.014	NALCN_MOUSE Sodium leak channel NALCN OS=Mus musculus OX=10090 GN=Nalcn PE=1 SV=2
19	A0A384ME80	3.7	33.5	283	0.013	0.046	A0A384ME80_HUMAN S-methyl-5'-thioadenosine phosphorylase OS=Homo sapiens OX=9606 GN=MTAP PE=2 SV=1
20	Q13126	3.7	33.5	283	0.013	0.046	MTAP_HUMAN S-methyl-5'-thioadenosine phosphorylase OS=Homo sapiens OX=9606 GN=MTAP PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13343 SBP_bac_6	1.7e+02	13.0	Bacterial extracellular solute-binding protein
2	PF07928 Vps54	1.4e-44	163.1	Vps54-like protein
3	PF10475 Vps54_N	5.3e-05	34.3	Vacuolar-sorting protein 54, of GARP complex
4	PF14164 YqzH	5.2e+02	12.1	YqzH-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000272322

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401435	0.999	Vacuolar protein sorting-associated protein 53 homolog
2	9606.ENSP00000409952	0.999	Vacuolar protein sorting-associated protein 52 homolog
3	9606.ENSP00000279281	0.998	Vacuolar protein sorting-associated protein 51 homolog
4	9606.ENSP00000258301	0.988	Syntaxin-6
5	9606.ENSP00000307666	0.986	Syndetin
6	9606.ENSP00000371559	0.966	EARP-interacting protein
7	9606.ENSP00000360183	0.947	Syntaxin-16
8	9606.ENSP00000315775	0.946	Conserved oligomeric Golgi complex subunit 4
9	9606.ENSP00000258654	0.929	Conserved oligomeric Golgi complex subunit 3
10	9606.ENSP00000236192	0.921	Vesicle-associated membrane protein 4
11	9606.ENSP00000397441	0.914	Conserved oligomeric Golgi complex subunit 6
12	9606.ENSP00000319781	0.906	Ras-related protein Rab-43
13	9606.ENSP00000305459	0.896	Conserved oligomeric Golgi complex subunit 8
14	9606.ENSP00000311449	0.894	Ras-related protein Rab-6A
15	9606.ENSP00000466298	0.874	Syntaxin-10
16	9606.ENSP00000305442	0.872	Conserved oligomeric Golgi complex subunit 7
17	9606.ENSP00000299138	0.844	Vacuolar protein sorting-associated protein 35
18	9606.ENSP00000381293	0.843	Vesicle-fusing ATPase
19	9606.ENSP00000299886	0.824	Conserved oligomeric Golgi complex subunit 1
20	9606.ENSP00000243918	0.807	Protein SYS1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016482	0.993	cytosolic transport
GO:0007041	0.988	lysosomal transport
GO:0016197	0.966	endosomal transport
GO:0042147	0.800	retrograde transport, endosome to Golgi
GO:0071840	0.527	cellular component organization or biogenesis
GO:0016043	0.524	cellular component organization
GO:0065007	0.485	biological regulation
GO:0050794	0.424	regulation of cellular process
GO:0006996	0.389	organelle organization
GO:0008152	0.317	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0099023	0.998	vesicle tethering complex
GO:0016020	0.998	membrane
GO:0031410	0.998	cytoplasmic vesicle
GO:0000938	0.987	GARP complex
GO:0031090	0.982	organelle membrane
GO:0032588	0.960	trans-Golgi network membrane
GO:0005829	0.938	cytosol
GO:0005634	0.804	nucleus
GO:0031974	0.686	membrane-enclosed lumen
GO:0043233	0.678	organelle lumen
GO:0070013	0.626	intracellular organelle lumen
GO:0098588	0.559	bounding membrane of organelle
GO:0031981	0.460	nuclear lumen
GO:0005654	0.448	nucleoplasm
GO:0005739	0.413	mitochondrion
GO:0005768	0.334	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]