StarFunc result for job id Q9P1T7

User Input

>input (246 residues)
MSGAGEALAPGPVGPQRVAEAGGGQLGSTAQGKCDKDNTEKDITQATNSHFTHGEMQDQS
IWGNPSDGELIRTQPQRLPQLQTSAQVPSGEEIGKIKNGHTGLSNGNGIHHGAKHGSADN
RKLSAPVSQKMHRKIQSSLSVNSDISKKSKVNAVFSQKTGSSPEDCCVHCILACLFCEFL
TLCNIVLGQASCGICTSEACCCCCGDEMGDDCNCPCDMDCGIMDACCESSDCLEICMECC
GICFPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P1T7	0.999	0.999	2.667E-34	246	1.000	1.000	Q9P1T7.pdb.gz	MDFIC_HUMAN MyoD family inhibitor domain-containing protein OS=Homo sapiens OX=9606 GN=MDFIC PE=1 SV=2
2	AFDB:Q8BX65	0.448	0.447	2.943E-26	247	0.817	0.814	Q8BX65.pdb.gz	MDFIC_MOUSE MyoD family inhibitor domain-containing protein OS=Mus musculus OX=10090 GN=Mdfic PE=1 SV=1
3	AFDB:Q98SK0	0.473	0.473	3.984E-22	246	0.654	0.654	Q98SK0.pdb.gz	MDFIC_XENLA MyoD family inhibitor domain-containing protein OS=Xenopus laevis OX=8355 GN=mdfic PE=2 SV=1
4	AFDB:Q99750	0.219	0.219	5.838E-9	246	0.411	0.411	Q99750.pdb.gz	MDFI_HUMAN MyoD family inhibitor OS=Homo sapiens OX=9606 GN=MDFI PE=1 SV=1
5	PDB:4f881	0.071	0.044	9.603	430	0.037	0.021	4f881.pdb.gz
6	AFDB:Q9W266	0.120	0.044	9.850	677	0.114	0.041	Q9W266.pdb.gz	WDP_DROME Protein windpipe OS=Drosophila melanogaster OX=7227 GN=wdp PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P1T7	0.0	497	246	1.000	1.000	MDFIC_HUMAN MyoD family inhibitor domain-containing protein OS=Homo sapiens OX=9606 GN=MDFIC PE=1 SV=2
2	Q8BX65	6.73e-134	379	247	0.817	0.814	MDFIC_MOUSE MyoD family inhibitor domain-containing protein OS=Mus musculus OX=10090 GN=Mdfic PE=1 SV=1
3	Q98SK0	2.38e-100	294	246	0.654	0.654	MDFIC_XENLA MyoD family inhibitor domain-containing protein OS=Xenopus laevis OX=8355 GN=mdfic PE=2 SV=1
4	Q99750	4.92e-30	114	246	0.309	0.309	MDFI_HUMAN MyoD family inhibitor OS=Homo sapiens OX=9606 GN=MDFI PE=1 SV=1
5	P38775	0.91	33.1	560	0.057	0.025	YHK5_YEAST Putative uncharacterized protein YHR045W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHR045W PE=4 SV=1
6	Q10407	1.5	32.7	1116	0.069	0.015	MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mkh1 PE=3 SV=1
7	Q9V727	2.4	32.0	1669	0.089	0.013	ASX_DROME Polycomb protein Asx OS=Drosophila melanogaster OX=7227 GN=Asx PE=1 SV=1
8	Q92954	4.2	31.2	1404	0.069	0.012	PRG4_HUMAN Proteoglycan 4 OS=Homo sapiens OX=9606 GN=PRG4 PE=1 SV=3
9	Q9JM99	4.2	31.2	1054	0.093	0.022	PRG4_MOUSE Proteoglycan 4 OS=Mus musculus OX=10090 GN=Prg4 PE=1 SV=2
10	Q14679	4.8	31.2	1199	0.085	0.018	TTLL4_HUMAN Tubulin monoglutamylase TTLL4 OS=Homo sapiens OX=9606 GN=TTLL4 PE=1 SV=2
11	Q9WTS5	8.0	30.4	2764	0.045	0.004	TEN2_MOUSE Teneurin-2 OS=Mus musculus OX=10090 GN=Tenm2 PE=1 SV=1
12	Q9VY99	10.0	30.0	1201	0.073	0.015	NNAD_DROME Cytosolic carboxypeptidase Nna1 OS=Drosophila melanogaster OX=7227 GN=Nna1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15316 MDFI	8.1e-67	236.0	MyoD family inhibitor
2	PF00835 SNAP-25	1e+02	14.5	SNAP-25 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484656

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000241651	0.907	Myogenin
2	9606.ENSP00000344456	0.907	Catenin beta-1
3	9606.ENSP00000228644	0.903	Myogenic factor 5
4	9606.ENSP00000261900	0.774	Cyclin-T1
5	9606.ENSP00000358755	0.762	Acidic mammalian chitinase
6	9606.ENSP00000264010	0.701	Transcriptional repressor CTCF
7	9606.ENSP00000458663	0.595	Protein capicua homolog
8	9606.ENSP00000481321	0.522	Gamma-aminobutyric acid receptor subunit rho-3
9	9606.ENSP00000378332	0.517	Transforming growth factor beta-1-induced transcript 1 protein
10	9606.ENSP00000297267	0.511	Fibronectin type III domain-containing protein 1
11	9606.ENSP00000322866	0.508	Olfactory receptor 52N5
12	9606.ENSP00000284601	0.500	Protein phosphatase 1 regulatory subunit 3A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140297	1.000	DNA-binding transcription factor binding
GO:0030332	0.964	cyclin binding
GO:0061629	0.960	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0030957	0.722	Tat protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.990	regulation of cellular process
GO:0006355	0.978	regulation of DNA-templated transcription
GO:0048518	0.960	positive regulation of biological process
GO:0048522	0.848	positive regulation of cellular process
GO:0045935	0.807	positive regulation of nucleobase-containing compound metabolic process
GO:0010604	0.754	positive regulation of macromolecule metabolic process
GO:0048583	0.732	regulation of response to stimulus
GO:0051254	0.726	positive regulation of RNA metabolic process
GO:0010646	0.725	regulation of cell communication
GO:0031328	0.718	positive regulation of cellular biosynthetic process
GO:0010557	0.657	positive regulation of macromolecule biosynthetic process
GO:0045893	0.646	positive regulation of DNA-templated transcription
GO:0023051	0.534	regulation of signaling
GO:0050792	0.527	regulation of viral process
GO:0009987	0.460	cellular process
GO:0009966	0.441	regulation of signal transduction
GO:0048519	0.330	negative regulation of biological process
GO:0048523	0.324	negative regulation of cellular process
GO:0048524	0.308	positive regulation of viral process
GO:0070302	0.305	regulation of stress-activated protein kinase signaling cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0031981	0.999	nuclear lumen
GO:0005730	0.994	nucleolus
GO:0005654	0.458	nucleoplasm
GO:0016020	0.314	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]