StarFunc result for job id Q9P1U0

User Input

>input (126 residues)
MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVV
FHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKF
QEKEDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P1U0	1.000	1.000	1.976E-23	126	1.000	1.000	Q9P1U0.pdb.gz	RPA12_HUMAN DNA-directed RNA polymerase I subunit RPA12 OS=Homo sapiens OX=9606 GN=POLR1H PE=1 SV=1
2	AFDB:Q791N7	0.615	0.627	5.003E-19	123	0.802	0.821	Q791N7.pdb.gz	RPA12_MOUSE DNA-directed RNA polymerase I subunit RPA12 OS=Mus musculus OX=10090 GN=Polr1h PE=1 SV=1
3	PDB:7vbcI	0.310	0.359	8.103E-11	107	0.849	1.000	7vbcI.pdb.gz	Structure of the human RNA polymerase I elongation complex.
4	AFDB:O94703	0.392	0.413	1.253E-9	119	0.302	0.319	O94703.pdb.gz	RPA12_SCHPO DNA-directed RNA polymerase I subunit RPA12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpa12 PE=1 SV=1
5	AFDB:P32529	0.449	0.453	1.411E-9	125	0.333	0.336	P32529.pdb.gz	RPA12_YEAST DNA-directed RNA polymerase I subunit RPA12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPA12 PE=1 SV=1
6	PDB:4c2mI	0.407	0.413	2.379E-9	124	0.333	0.339	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
7	PDB:6hlqI	0.315	0.354	6.266E-7	111	0.341	0.387	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
8	AFDB:Q9P9I8	0.414	0.491	6.337E-7	105	0.222	0.267	Q9P9I8.pdb.gz	TFS_METTL Transcription factor S OS=Methanothermococcus thermolithotrophicus OX=2186 GN=tfs PE=3 SV=1
9	AFDB:A0A384LJI7	0.384	0.450	7.135E-7	106	0.222	0.264	A0A384LJI7.pdb.gz	A0A384LJI7_ARATH DNA-directed RNA polymerase subunit OS=Arabidopsis thaliana OX=3702 GN=At1g01210 PE=1 SV=1
10	AFDB:Q56254	0.362	0.413	1.081E-6	110	0.222	0.255	Q56254.pdb.gz	TFS_THECE Transcription factor S OS=Thermococcus celer OX=2264 GN=tfs PE=1 SV=1
11	AFDB:Q04307	0.378	0.429	2.336E-6	110	0.254	0.291	Q04307.pdb.gz	RPC10_YEAST DNA-directed RNA polymerase III subunit RPC10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPC11 PE=1 SV=1
12	AFDB:Q980K2	0.375	0.412	7.206E-6	114	0.262	0.289	Q980K2.pdb.gz	TFS1_SACS2 Transcription factor S1 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=tfs1 PE=1 SV=1
13	PDB:7z1lI	0.343	0.390	8.511E-6	110	0.230	0.264	7z1lI.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
14	AFDB:O13896	0.377	0.432	1.091E-5	109	0.230	0.266	O13896.pdb.gz	RPC10_SCHPO DNA-directed RNA polymerase III subunit RPC10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc11 PE=3 SV=1
15	PDB:5fj9I	0.328	0.440	2.071E-5	92	0.214	0.293	5fj9I.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.
16	PDB:5n5yI	0.295	0.365	3.747E-5	99	0.270	0.343	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
17	PDB:7eu0I	0.335	0.366	9.677E-5	113	0.198	0.221	7eu0I.pdb.gz	Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
18	PDB:7oqyY	0.214	0.291	1.466E-4	92	0.190	0.261	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
19	PDB:1i3qI	0.343	0.352	1.315E-3	122	0.190	0.197	1i3qI.pdb.gz	Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
20	PDB:3h0gI	0.322	0.359	1.768E-3	111	0.198	0.225	3h0gI.pdb.gz	Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P1U0	5.18e-92	263	126	1.000	1.000	RPA12_HUMAN DNA-directed RNA polymerase I subunit RPA12 OS=Homo sapiens OX=9606 GN=POLR1H PE=1 SV=1
2	Q791N7	1.53e-72	214	123	0.802	0.821	RPA12_MOUSE DNA-directed RNA polymerase I subunit RPA12 OS=Mus musculus OX=10090 GN=Polr1h PE=1 SV=1
3	O94703	3.11e-17	73.6	119	0.325	0.345	RPA12_SCHPO DNA-directed RNA polymerase I subunit RPA12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpa12 PE=1 SV=1
4	P32529	4.10e-17	73.6	125	0.341	0.344	RPA12_YEAST DNA-directed RNA polymerase I subunit RPA12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPA12 PE=1 SV=1
5	Q9ZQC0	1.05e-09	53.9	106	0.294	0.349	Q9ZQC0_ARATH DNA-directed RNA polymerase subunit OS=Arabidopsis thaliana OX=3702 GN=At4g07950 PE=1 SV=1
6	A0A384LJI7	3.26e-09	52.8	106	0.286	0.340	A0A384LJI7_ARATH DNA-directed RNA polymerase subunit OS=Arabidopsis thaliana OX=3702 GN=At1g01210 PE=1 SV=1
7	Q980K2	3.41e-07	47.8	114	0.254	0.281	TFS1_SACS2 Transcription factor S1 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=tfs1 PE=1 SV=1
8	Q56254	8.69e-07	46.6	110	0.230	0.264	TFS_THECE Transcription factor S OS=Thermococcus celer OX=2264 GN=tfs PE=1 SV=1
9	Q04307	2.45e-04	40.0	110	0.254	0.291	RPC10_YEAST DNA-directed RNA polymerase III subunit RPC10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPC11 PE=1 SV=1
10	Q383N7	4.34e-04	40.0	151	0.183	0.152	Q383N7_TRYB2 DNA-directed RNA polymerase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2190 PE=4 SV=1
11	Q97X43	5.74e-04	38.5	92	0.222	0.304	TFS4_SACS2 Transcription factor S4 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=tfs4 PE=1 SV=1
12	O13896	7.84e-04	38.5	109	0.246	0.284	RPC10_SCHPO DNA-directed RNA polymerase III subunit RPC10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc11 PE=3 SV=1
13	Q9P9I8	0.001	38.1	105	0.222	0.267	TFS_METTL Transcription factor S OS=Methanothermococcus thermolithotrophicus OX=2186 GN=tfs PE=3 SV=1
14	O74635	0.002	37.7	113	0.262	0.292	RPB9_SCHPO DNA-directed RNA polymerase II subunit RPB9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpb9 PE=1 SV=1
15	Q6DGU0	0.002	37.4	108	0.278	0.324	Q6DGU0_DANRE DNA-directed RNA polymerase subunit OS=Danio rerio OX=7955 GN=zgc:92774 PE=2 SV=1
16	Q9ZVH8	0.002	38.9	378	0.127	0.042	RDO2_ARATH Transcription elongation factor TFIIS OS=Arabidopsis thaliana OX=3702 GN=TFIIS PE=1 SV=1
17	P27999	0.003	37.4	122	0.183	0.189	RPB9_YEAST DNA-directed RNA polymerase II subunit RPB9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPB9 PE=1 SV=1
18	P36958	0.006	36.6	129	0.167	0.163	RPB9_DROME DNA-directed RNA polymerase II subunit RPB9 OS=Drosophila melanogaster OX=7227 GN=RpII15 PE=2 SV=2
19	Q9Y2Y1	0.009	35.8	108	0.270	0.315	RPC10_HUMAN DNA-directed RNA polymerase III subunit RPC10 OS=Homo sapiens OX=9606 GN=POLR3K PE=1 SV=3
20	P07273	0.099	33.9	309	0.143	0.058	TFS2_YEAST Transcription elongation factor S-II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DST1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08792 A2L_zn_ribbon	8.8e+02	11.1	A2L zinc ribbon domain
2	PF03604 DNA_RNApol_7kD	8.5e+02	11.1	DNA directed RNA polymerase, 7 kDa subunit
3	PF12773 DZR	4.8	18.6	Double zinc ribbon
4	PF15731 MqsA_antitoxin	1.9e+02	13.6	Antitoxin component of bacterial toxin-antitoxin system, MqsA
5	PF10122 Mu-like_Com	22	15.9	Mu-like prophage protein Com
6	PF04606 Ogr_Delta	30	15.9	Ogr/Delta-like zinc finger
7	PF07282 OrfB_Zn_ribbon	1.6	20.1	Putative transposase DNA-binding domain
8	PF02150 RNA_POL_M_15KD	39	15.5	RNA polymerases M/15 Kd subunit
9	PF01096 TFIIS_C	3.8e-12	57.2	Transcription factor S-II (TFIIS)
10	PF18439 zf_UBZ	4.6e+02	11.9	Ubiquitin-Binding Zinc Finger
11	PF13240 zinc_ribbon_2	7e+02	11.4	zinc-ribbon domain
12	PF12760 Zn_Tnp_IS1595	9e+02	11.2	Transposase zinc-ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331111

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222567	0.999	DNA-directed RNA polymerase I subunit RPA43
2	9606.ENSP00000302478	0.999	DNA-directed RNA polymerases I and III subunit RPAC2
3	9606.ENSP00000361465	0.999	DNA-directed RNA polymerases I and III subunit RPAC1
4	9606.ENSP00000367029	0.999	DNA-directed RNA polymerase I subunit RPA49
5	9606.ENSP00000415536	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC3
6	9606.ENSP00000444136	0.999	DNA-directed RNA polymerase I subunit RPA2
7	9606.ENSP00000478303	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC1
8	9606.ENSP00000324124	0.998	DNA-directed RNA polymerases I, II, and III subunit RPABC5
9	9606.ENSP00000342889	0.998	DNA-directed RNA polymerases I, II, and III subunit RPABC4
10	9606.ENSP00000403852	0.998	DNA-directed RNA polymerases I, II, and III subunit RPABC2
11	9606.ENSP00000263857	0.996	DNA-directed RNA polymerase I subunit RPA1
12	9606.ENSP00000198767	0.941	RNA polymerase I-specific transcription initiation factor RRN3
13	9606.ENSP00000293860	0.927	DNA-directed RNA polymerase III subunit RPC10
14	9606.ENSP00000479169	0.916	Histone H2B type 1-H
15	9606.ENSP00000296417	0.914	Histone H2A.Z
16	9606.ENSP00000289316	0.912	Histone H2B type 1-D
17	9606.ENSP00000434024	0.912	Histone H2AX
18	9606.ENSP00000308405	0.911	Histone H2A.V
19	9606.ENSP00000332194	0.911	Histone H2A type 2-C
20	9606.ENSP00000328484	0.910	Histone H2A type 1-J

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.539	catalytic activity
GO:0016740	0.346	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044238	0.999	primary metabolic process
GO:0044237	0.999	cellular metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0006139	0.993	nucleobase-containing compound metabolic process
GO:0043170	0.714	macromolecule metabolic process
GO:0090304	0.553	nucleic acid metabolic process
GO:0016070	0.520	RNA metabolic process
GO:0010467	0.518	gene expression
GO:0009058	0.482	biosynthetic process
GO:1901576	0.464	organic substance biosynthetic process
GO:0044271	0.456	cellular nitrogen compound biosynthetic process
GO:0009059	0.451	macromolecule biosynthetic process
GO:0050789	0.420	regulation of biological process
GO:0050794	0.366	regulation of cellular process
GO:1901362	0.365	organic cyclic compound biosynthetic process
GO:0019438	0.365	aromatic compound biosynthetic process
GO:0018130	0.364	heterocycle biosynthetic process
GO:0006351	0.337	DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.304	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.346	Transferases.

[back to server]