StarFunc result for job id Q9P1U1

User Input

>input (418 residues)
MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDF
FIGDEAIDKPTYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTP
ENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVK
EFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVV
DEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKP
KPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61157	0.983	0.983	1.678E-78	418	0.907	0.907	P61157.pdb.gz	ARP3_BOVIN Actin-related protein 3 OS=Bos taurus OX=9913 GN=ACTR3 PE=1 SV=3
2	AFDB:P32392	0.992	0.992	5.418E-77	418	0.797	0.797	P32392.pdb.gz	ARP3_DROME Actin-related protein 3 OS=Drosophila melanogaster OX=7227 GN=Arp3 PE=2 SV=3
3	AFDB:Q9N4I0	0.985	0.969	5.893E-71	425	0.727	0.715	Q9N4I0.pdb.gz	ARP3_CAEEL Actin-related protein 3 OS=Caenorhabditis elegans OX=6239 GN=arx-1 PE=1 SV=1
4	AFDB:P42528	0.955	0.955	1.868E-65	418	0.658	0.658	P42528.pdb.gz	ARP3_DICDI Actin-related protein 3 OS=Dictyostelium discoideum OX=44689 GN=arpC PE=1 SV=1
5	AFDB:Q9SAF1	0.926	0.907	3.036E-61	427	0.577	0.564	Q9SAF1.pdb.gz	ARP3_ARATH Actin-related protein 3 OS=Arabidopsis thaliana OX=3702 GN=ARP3 PE=1 SV=1
6	AFDB:Q59Z11	0.930	0.928	8.326E-61	419	0.603	0.601	Q59Z11.pdb.gz	Q59Z11_CANAL Actin-related protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARP3 PE=3 SV=1
7	AFDB:P32390	0.935	0.915	6.623E-60	427	0.598	0.585	P32390.pdb.gz	ARP3_SCHPO Actin-related protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=act2 PE=1 SV=1
8	AFDB:P47117	0.922	0.859	1.227E-59	449	0.610	0.568	P47117.pdb.gz	ARP3_YEAST Actin-related protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARP3 PE=1 SV=1
9	PDB:7aqka	0.851	0.851	2.005E-55	418	0.900	0.900	7aqka.pdb.gz
10	PDB:3dwlA	0.794	0.930	1.467E-48	355	0.555	0.654	3dwlA.pdb.gz	Structure and biochemical properties of fission yeast arp2/3 complex lacking the arp2 subunit.
11	PDB:6w17A	0.833	0.913	4.692E-45	380	0.579	0.637	6w17A.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.
12	AFDB:P07829	0.788	0.873	4.329E-41	376	0.349	0.388	P07829.pdb.gz	ACT3_DICDI Actin-3 OS=Dictyostelium discoideum OX=44689 GN=act3 PE=3 SV=3
13	AFDB:B6VNT8	0.796	0.879	7.583E-41	377	0.352	0.390	B6VNT8.pdb.gz	B6VNT8_PIG Actin alpha cardiac muscle 1 OS=Sus scrofa OX=9823 GN=ACTC1 PE=1 SV=1
14	PDB:1yagA	0.804	0.899	1.194E-40	372	0.333	0.374	1yagA.pdb.gz	The structure of nonvertebrate actin: Implications for the ATP hydrolytic mechanism
15	PDB:4cbxA	0.803	0.932	6.786E-40	358	0.347	0.405	4cbxA.pdb.gz	Structural Differences Explain Diverse Functions of Plasmodium Actins.
16	PDB:1c0gA	0.804	0.910	1.329E-39	368	0.333	0.378	1c0gA.pdb.gz	Structural basis for the higher Ca(2+)-activation of the regulated actin-activated myosin ATPase observed with Dictyostelium/Tetrahymena actin chimeras.
17	PDB:6tu4A	0.757	0.843	1.058E-38	372	0.352	0.395	6tu4A.pdb.gz	High-resolution structures of malaria parasite actomyosin and actin filaments.
18	PDB:4pl7A	0.778	0.849	4.003E-35	382	0.330	0.361	4pl7A.pdb.gz	Structural basis of thymosin-beta 4/profilin exchange leading to actin filament polymerization.
19	PDB:4a7fA	0.733	0.808	2.372E-31	375	0.349	0.389	4a7fA.pdb.gz	Structure of the Rigor Actin-Tropomyosin-Myosin Complex.
20	PDB:6w18B	0.741	0.838	5.709E-27	367	0.304	0.346	6w18B.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P32392	0.0	705	418	0.797	0.797	ARP3_DROME Actin-related protein 3 OS=Drosophila melanogaster OX=7227 GN=Arp3 PE=2 SV=3
2	P42528	0.0	566	418	0.660	0.660	ARP3_DICDI Actin-related protein 3 OS=Dictyostelium discoideum OX=44689 GN=arpC PE=1 SV=1
3	P61157	0.0	786	418	0.907	0.907	ARP3_BOVIN Actin-related protein 3 OS=Bos taurus OX=9913 GN=ACTR3 PE=1 SV=3
4	P61158	0.0	786	418	0.907	0.907	ARP3_HUMAN Actin-related protein 3 OS=Homo sapiens OX=9606 GN=ACTR3 PE=1 SV=3
5	Q4V7C7	0.0	785	418	0.904	0.904	ARP3_RAT Actin-related protein 3 OS=Rattus norvegicus OX=10116 GN=Actr3 PE=1 SV=1
6	Q801P7	0.0	778	418	0.890	0.890	ARP3A_XENLA Actin-related protein 3-A OS=Xenopus laevis OX=8355 GN=actr3-a PE=1 SV=1
7	Q99JY9	0.0	785	418	0.904	0.904	ARP3_MOUSE Actin-related protein 3 OS=Mus musculus OX=10090 GN=Actr3 PE=1 SV=3
8	Q9N4I0	0.0	659	425	0.737	0.725	ARP3_CAEEL Actin-related protein 3 OS=Caenorhabditis elegans OX=6239 GN=arx-1 PE=1 SV=1
9	Q9P1U1	0.0	865	418	1.000	1.000	ARP3B_HUMAN Actin-related protein 3B OS=Homo sapiens OX=9606 GN=ACTR3B PE=2 SV=1
10	Q9SAF1	0.0	523	427	0.603	0.590	ARP3_ARATH Actin-related protein 3 OS=Arabidopsis thaliana OX=3702 GN=ARP3 PE=1 SV=1
11	Q59Z11	1.90e-174	495	419	0.603	0.601	Q59Z11_CANAL Actin-related protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARP3 PE=3 SV=1
12	P32390	3.38e-173	493	427	0.600	0.588	ARP3_SCHPO Actin-related protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=act2 PE=1 SV=1
13	P47117	4.60e-171	488	449	0.617	0.575	ARP3_YEAST Actin-related protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARP3 PE=1 SV=1
14	Q9C0K3	1.31e-132	381	210	0.445	0.886	ARP3C_HUMAN Actin-related protein 3C OS=Homo sapiens OX=9606 GN=ACTR3C PE=2 SV=1
15	P86287	2.32e-85	267	376	0.368	0.410	ACT1_PLAFX Actin-1 OS=Plasmodium falciparum (isolate HB3) OX=137071 GN=ACT1 PE=1 SV=1
16	Q8I4X0	2.32e-85	267	376	0.368	0.410	ACT1_PLAF7 Actin-1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=ACT1 PE=1 SV=1
17	Q4Z1L3	3.73e-85	266	376	0.366	0.407	ACT1_PLABA Actin-1 OS=Plasmodium berghei (strain Anka) OX=5823 GN=ACT1 PE=1 SV=2
18	P53498	1.69e-82	259	377	0.359	0.398	ACT_CHLRE Actin OS=Chlamydomonas reinhardtii OX=3055 PE=1 SV=1
19	P10984	5.26e-82	258	376	0.364	0.404	ACT2_CAEEL Actin-2 OS=Caenorhabditis elegans OX=6239 GN=act-2 PE=3 SV=3
20	P60706	6.33e-82	258	375	0.361	0.403	ACTB_CHICK Actin, cytoplasmic 1 OS=Gallus gallus OX=9031 GN=ACTB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00022 Actin	4.2e-85	297.3	Actin
2	PF17989 ALP_N	1.4e+02	14.1	Actin like proteins N terminal domain
3	PF04383 KilA-N	1.1e+02	14.1	KilA-N domain
4	PF06723 MreB_Mbl	0.037	24.5	MreB/Mbl protein
5	PF03259 Robl_LC7	2.2e+02	13.0	Roadblock/LC7 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010382361.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010354124.1	0.999	ATP-binding component of the Arp2/3 complex, a multiprotein complex that mediates actin polymerization upon stimulation by nucleation-promoting factor (NPF). The Arp2/3 complex mediates the formation of branched actin networks in the cytoplasm, providing the force for cell motility. Seems to contact the pointed end of the daughter actin filament
2	61622.XP_010366290.1	0.996	Neural Wiskott-Aldrich syndrome protein
3	61622.XP_010374065.1	0.995	Actin-related protein 2/3 complex subunit 1B
4	61622.XP_010358515.1	0.994	Actin-related protein 2/3 complex subunit 2
5	61622.XP_010367249.1	0.993	Actin-related protein 2/3 complex subunit 5
6	61622.XP_010377526.1	0.992	Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks
7	61622.XP_010367710.1	0.991	Actin-related protein 2/3 complex subunit 4
8	61622.XP_010359397.1	0.985	Wiskott-Aldrich syndrome
9	61622.XP_010374067.1	0.984	Actin-related protein 2/3 complex subunit 1A
10	61622.XP_010364159.1	0.969	Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Arp2/3 complex plays a critical role in the control of cell morphogenesis via the modulation of cell polarity development
11	61622.XP_010380400.1	0.966	Cortactin
12	61622.XP_010378678.1	0.963	wiskott-Aldrich syndrome protein family member 2
13	61622.XP_010368818.1	0.947	Hematopoietic cell-specific Lyn substrate 1
14	61622.XP_010352583.1	0.936	Actin gamma 1
15	61622.XP_010365296.1	0.936	Actin, cytoplasmic 1
16	61622.XP_010368574.1	0.907	NCK interacting protein with SH3 domain
17	61622.XP_010370898.1	0.842	Dynamin-3-like isoform X1
18	61622.XP_010373392.1	0.838	WAS protein family member 3
19	61622.XP_010364318.1	0.826	WAS protein family member 1
20	61622.XP_010372847.1	0.815	Drebrin like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.797	cytoskeletal protein binding
GO:0003779	0.728	actin binding
GO:1901363	0.470	heterocyclic compound binding
GO:0097159	0.470	organic cyclic compound binding
GO:0044877	0.394	protein-containing complex binding
GO:0051015	0.371	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0006996	0.986	organelle organization
GO:0044087	0.978	regulation of cellular component biogenesis
GO:0048522	0.976	positive regulation of cellular process
GO:0031344	0.976	regulation of cell projection organization
GO:0120034	0.971	positive regulation of plasma membrane bounded cell projection assembly
GO:1902743	0.968	regulation of lamellipodium organization
GO:0007015	0.942	actin filament organization
GO:1902745	0.908	positive regulation of lamellipodium organization
GO:0032502	0.886	developmental process
GO:0048856	0.869	anatomical structure development
GO:0010591	0.868	regulation of lamellipodium assembly
GO:0010592	0.831	positive regulation of lamellipodium assembly
GO:0019222	0.824	regulation of metabolic process
GO:0060255	0.757	regulation of macromolecule metabolic process
GO:0080090	0.733	regulation of primary metabolic process
GO:0051171	0.732	regulation of nitrogen compound metabolic process
GO:0022607	0.731	cellular component assembly
GO:0010604	0.726	positive regulation of macromolecule metabolic process
GO:0031323	0.721	regulation of cellular metabolic process
GO:0050803	0.720	regulation of synapse structure or activity
GO:0032501	0.707	multicellular organismal process
GO:0019219	0.647	regulation of nucleobase-containing compound metabolic process
GO:0033043	0.625	regulation of organelle organization
GO:0050896	0.539	response to stimulus
GO:0050807	0.519	regulation of synapse organization
GO:0050793	0.472	regulation of developmental process
GO:0030030	0.450	cell projection organization
GO:0051173	0.449	positive regulation of nitrogen compound metabolic process
GO:0031325	0.433	positive regulation of cellular metabolic process
GO:0051716	0.431	cellular response to stimulus
GO:0022603	0.406	regulation of anatomical structure morphogenesis
GO:0051179	0.393	localization
GO:0009889	0.392	regulation of biosynthetic process
GO:0051239	0.377	regulation of multicellular organismal process
GO:0048523	0.377	negative regulation of cellular process
GO:0051960	0.359	regulation of nervous system development
GO:0051252	0.359	regulation of RNA metabolic process
GO:0010468	0.303	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005829	0.997	cytosol
GO:0031982	0.996	vesicle
GO:0005615	0.995	extracellular space
GO:0070062	0.994	extracellular exosome
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0032991	0.982	protein-containing complex
GO:0005634	0.982	nucleus
GO:0043232	0.980	intracellular non-membrane-bounded organelle
GO:0042995	0.906	cell projection
GO:0016020	0.902	membrane
GO:0120025	0.894	plasma membrane bounded cell projection
GO:0030054	0.886	cell junction
GO:0005694	0.839	chromosome
GO:0005856	0.822	cytoskeleton
GO:0070161	0.782	anchoring junction
GO:0015629	0.772	actin cytoskeleton
GO:0031252	0.767	cell leading edge
GO:0030027	0.696	lamellipodium
GO:0030055	0.655	cell-substrate junction
GO:0005925	0.571	focal adhesion
GO:0031981	0.571	nuclear lumen
GO:0012505	0.387	endomembrane system
GO:0005885	0.382	Arp2/3 protein complex
GO:0005654	0.367	nucleoplasm
GO:0005886	0.329	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]