StarFunc result for job id Q9P1W8

User Input

>input (387 residues)
MPVPASWPHPPGPFLLLTLLLGLTEVAGEEELQMIQPEKLLLVTVGKTATLHCTVTSLLP
VGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCV
KFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDITL
KWFKNGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVICEVAHVTLQGDPLRG
TANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKFYPQSLQLTWSENGNVCQRETASTL
TENKDGTYNWTSWFLVNISDQRDDVVLTCQVKHDGQLAVSKRLALEVTVHQKDQSSDATP
GPASSLTALLLIAVLLGPIYVPWKQKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P1W8	1.000	1.000	4.783E-66	387	1.000	1.000	Q9P1W8.pdb.gz	SIRPG_HUMAN Signal-regulatory protein gamma OS=Homo sapiens OX=9606 GN=SIRPG PE=1 SV=3
2	AFDB:O00241	0.573	0.558	3.805E-50	398	0.739	0.719	O00241.pdb.gz	SIRB1_HUMAN Signal-regulatory protein beta-1 OS=Homo sapiens OX=9606 GN=SIRPB1 PE=1 SV=5
3	AFDB:P78324	0.561	0.438	1.115E-48	504	0.711	0.546	P78324.pdb.gz	SHPS1_HUMAN Tyrosine-protein phosphatase non-receptor type substrate 1 OS=Homo sapiens OX=9606 GN=SIRPA PE=1 SV=2
4	AFDB:P97797	0.565	0.436	3.743E-42	513	0.530	0.400	P97797.pdb.gz	SHPS1_MOUSE Tyrosine-protein phosphatase non-receptor type substrate 1 OS=Mus musculus OX=10090 GN=Sirpa PE=1 SV=2
5	AFDB:P97710	0.542	0.421	2.784E-41	509	0.496	0.377	P97710.pdb.gz	SHPS1_RAT Tyrosine-protein phosphatase non-receptor type substrate 1 OS=Rattus norvegicus OX=10116 GN=Sirpa PE=1 SV=1
6	AFDB:Q8BLX5	0.583	0.594	5.010E-41	379	0.512	0.522	Q8BLX5.pdb.gz	Q8BLX5_MOUSE Ig-like domain-containing protein OS=Mus musculus OX=10090 GN=Sirpb1a PE=2 SV=1
7	AFDB:A0A0A6YYP6	0.571	0.558	6.081E-40	397	0.519	0.506	A0A0A6YYP6.pdb.gz	A0A0A6YYP6_MOUSE Signal-regulatory protein beta 1A OS=Mus musculus OX=10090 GN=Sirpb1a PE=4 SV=1
8	AFDB:Q1WIM2	0.618	0.559	7.069E-18	435	0.178	0.159	Q1WIM2.pdb.gz	CADM2_RAT Cell adhesion molecule 2 OS=Rattus norvegicus OX=10116 GN=Cadm2 PE=1 SV=2
9	AFDB:Q7SZQ3	0.273	0.225	6.717E-17	499	0.189	0.146	Q7SZQ3.pdb.gz
10	AFDB:Q6PFK4	0.568	0.546	1.702E-16	405	0.171	0.163	Q6PFK4.pdb.gz	Q6PFK4_DANRE Cell adhesion molecule 2a OS=Danio rerio OX=7955 GN=zgc:66339 PE=1 SV=1
11	PDB:2rcjC	0.277	0.226	1.104E-14	523	0.183	0.136	2rcjC.pdb.gz
12	PDB:1igtB	0.261	0.234	5.275E-13	444	0.176	0.153	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
13	PDB:1hzhH	0.249	0.214	1.212E-12	457	0.191	0.162	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
14	PDB:1igaA	0.248	0.207	1.545E-11	475	0.176	0.143	1igaA.pdb.gz
15	PDB:5c7kF	0.269	0.460	4.113E-11	212	0.129	0.236	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
16	PDB:1gpoM	0.266	0.443	9.452E-11	218	0.137	0.243	1gpoM.pdb.gz
17	PDB:1fdlL	0.248	0.417	1.542E-10	214	0.137	0.248	1fdlL.pdb.gz
18	PDB:1n0xL	0.262	0.444	1.619E-10	215	0.134	0.242	1n0xL.pdb.gz	Crystal Structure of a Broadly Neutralizing Anti-HIV-1 Antibody in Complex with a Peptide Mimotope
19	PDB:4hixL	0.252	0.418	1.619E-10	219	0.137	0.242	4hixL.pdb.gz	Bapineuzumab captures the N-terminus of the Alzheimer's disease amyloid-beta peptide in a helical conformation.
20	PDB:2qhrL	0.267	0.401	1.786E-10	218	0.121	0.216	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00241	0.0	591	398	0.765	0.744	SIRB1_HUMAN Signal-regulatory protein beta-1 OS=Homo sapiens OX=9606 GN=SIRPB1 PE=1 SV=5
2	P78324	0.0	567	504	0.695	0.534	SHPS1_HUMAN Tyrosine-protein phosphatase non-receptor type substrate 1 OS=Homo sapiens OX=9606 GN=SIRPA PE=1 SV=2
3	Q9P1W8	0.0	795	387	1.000	1.000	SIRPG_HUMAN Signal-regulatory protein gamma OS=Homo sapiens OX=9606 GN=SIRPG PE=1 SV=3
4	A0A0A6YYP6	2.30e-144	417	397	0.553	0.539	A0A0A6YYP6_MOUSE Signal-regulatory protein beta 1A OS=Mus musculus OX=10090 GN=Sirpb1a PE=4 SV=1
5	Q6F5F2	6.41e-143	413	391	0.568	0.563	Q6F5F2_MOUSE SIRP-beta B-type OS=Mus musculus OX=10090 GN=Sirpb1a PE=2 SV=1
6	Q8BLX5	4.49e-142	410	379	0.504	0.515	Q8BLX5_MOUSE Ig-like domain-containing protein OS=Mus musculus OX=10090 GN=Sirpb1a PE=2 SV=1
7	Q6F5F0	1.67e-141	409	391	0.530	0.524	Q6F5F0_MOUSE SIRP-beta B-type OS=Mus musculus OX=10090 GN=Sirpb1a PE=2 SV=1
8	P97797	3.01e-135	398	513	0.501	0.378	SHPS1_MOUSE Tyrosine-protein phosphatase non-receptor type substrate 1 OS=Mus musculus OX=10090 GN=Sirpa PE=1 SV=2
9	P97710	8.45e-126	374	509	0.473	0.360	SHPS1_RAT Tyrosine-protein phosphatase non-receptor type substrate 1 OS=Rattus norvegicus OX=10116 GN=Sirpa PE=1 SV=1
10	A0A0A6YWR3	1.05e-68	216	182	0.261	0.555	A0A0A6YWR3_MOUSE Signal-regulatory protein beta 1A (Fragment) OS=Mus musculus OX=10090 GN=Sirpb1a PE=4 SV=1
11	Q9V787	5.42e-09	60.5	1235	0.173	0.054	Q9V787_DROME Hibris OS=Drosophila melanogaster OX=7227 GN=hbs PE=1 SV=3
12	A1Z9X4	5.47e-09	60.5	1235	0.173	0.054	A1Z9X4_DROME Hibris, isoform B OS=Drosophila melanogaster OX=7227 GN=hbs PE=4 SV=1
13	Q8MRA3	6.23e-09	60.5	1228	0.173	0.055	Q8MRA3_DROME Hibris, isoform A OS=Drosophila melanogaster OX=7227 GN=hbs PE=2 SV=1
14	Q99N28	7.13e-09	59.3	396	0.155	0.152	CADM3_MOUSE Cell adhesion molecule 3 OS=Mus musculus OX=10090 GN=Cadm3 PE=1 SV=1
15	Q967D7	4.27e-08	57.8	1531	0.168	0.042	TUTL_DROME Protein turtle OS=Drosophila melanogaster OX=7227 GN=tutl PE=1 SV=2
16	A0A0B4K7N1	6.92e-08	57.0	986	0.196	0.077	A0A0B4K7N1_DROME Sidestep, isoform C OS=Drosophila melanogaster OX=7227 GN=side PE=4 SV=1
17	Q8N126	7.92e-08	56.2	398	0.155	0.151	CADM3_HUMAN Cell adhesion molecule 3 OS=Homo sapiens OX=9606 GN=CADM3 PE=1 SV=1
18	Q967X6	8.43e-08	56.6	939	0.196	0.081	Q967X6_DROME Sidestep OS=Drosophila melanogaster OX=7227 GN=side PE=2 SV=1
19	Q9VB35	8.50e-08	56.6	939	0.196	0.081	Q9VB35_DROME Sidestep, isoform A OS=Drosophila melanogaster OX=7227 GN=side PE=1 SV=2
20	A0A0B4K6K0	8.59e-08	56.6	943	0.196	0.081	A0A0B4K6K0_DROME Sidestep, isoform D OS=Drosophila melanogaster OX=7227 GN=side PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	5.9e-21	86.0	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	1.2e-14	65.5	CD80-like C2-set immunoglobulin domain
3	PF08662 eIF2A	1.1e+02	14.1	Eukaryotic translation initiation factor eIF2A
4	PF07679 I-set	2.9e-08	45.0	Immunoglobulin I-set domain
5	PF00047 ig	8e-11	53.3	Immunoglobulin domain
6	PF13895 Ig_2	2.1e-11	55.2	Immunoglobulin domain
7	PF13927 Ig_3	1.3e-15	69.0	Immunoglobulin domain
8	PF06328 Lep_receptor_Ig	62	15.0	Ig-like C2-type domain
9	PF07686 V-set	2.8e-12	58.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305529

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355361	0.999	Leukocyte surface antigen CD47
2	9606.ENSP00000262629	0.945	TYRO protein tyrosine kinase-binding protein
3	9606.ENSP00000382941	0.909	Tyrosine-protein phosphatase non-receptor type substrate 1
4	9606.ENSP00000364907	0.821	Tyrosine-protein kinase SYK
5	9606.ENSP00000362205	0.803	Triggering receptor expressed on myeloid cells 2
6	9606.ENSP00000340944	0.724	Tyrosine-protein phosphatase non-receptor type 11
7	9606.ENSP00000317327	0.575	Ubiquitin-associated and SH3 domain-containing protein A
8	9606.ENSP00000358490	0.556	T-cell surface antigen CD2
9	9606.ENSP00000273859	0.547	Probable phospholipid-transporting ATPase VD
10	9606.ENSP00000321038	0.537	Lysoplasmalogenase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0009987	0.997	cellular process
GO:0023052	0.996	signaling
GO:0050794	0.987	regulation of cellular process
GO:0007154	0.986	cell communication
GO:0051716	0.986	cellular response to stimulus
GO:0048518	0.928	positive regulation of biological process
GO:0007165	0.927	signal transduction
GO:0050865	0.926	regulation of cell activation
GO:0002682	0.853	regulation of immune system process
GO:0002694	0.729	regulation of leukocyte activation
GO:0051249	0.656	regulation of lymphocyte activation
GO:0030155	0.653	regulation of cell adhesion
GO:0002684	0.516	positive regulation of immune system process
GO:0007166	0.503	cell surface receptor signaling pathway
GO:0048522	0.496	positive regulation of cellular process
GO:0048519	0.446	negative regulation of biological process
GO:0042127	0.442	regulation of cell population proliferation
GO:0051240	0.423	positive regulation of multicellular organismal process
GO:0002696	0.408	positive regulation of leukocyte activation
GO:0048583	0.391	regulation of response to stimulus
GO:0035556	0.373	intracellular signal transduction
GO:0060255	0.371	regulation of macromolecule metabolic process
GO:1903037	0.354	regulation of leukocyte cell-cell adhesion
GO:0051251	0.302	positive regulation of lymphocyte activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.880	intracellular membrane-bounded organelle
GO:0005737	0.838	cytoplasm
GO:0012505	0.431	endomembrane system
GO:0031982	0.359	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]