StarFunc result for job id Q9P1W9

User Input

>input (311 residues)
MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P1W9	1.000	1.000	1.728E-66	311	1.000	1.000	Q9P1W9.pdb.gz	PIM2_HUMAN Serine/threonine-protein kinase pim-2 OS=Homo sapiens OX=9606 GN=PIM2 PE=1 SV=1
2	AFDB:Q62070	0.883	0.744	6.303E-58	370	0.894	0.751	Q62070.pdb.gz	PIM2_MOUSE Serine/threonine-protein kinase pim-2 OS=Mus musculus OX=10090 GN=Pim2 PE=1 SV=1
3	PDB:2iwiB	0.790	0.985	9.797E-45	249	0.794	0.992	2iwiB.pdb.gz	Crystal structure of the PIM2 kinase in complex with an organoruthenium inhibitor.
4	AFDB:O70444	0.851	0.813	3.910E-41	326	0.569	0.543	O70444.pdb.gz	PIM3_RAT Serine/threonine-protein kinase pim-3 OS=Rattus norvegicus OX=10116 GN=Pim3 PE=1 SV=3
5	AFDB:A0A024RD25	0.841	0.836	2.875E-40	313	0.556	0.553	A0A024RD25.pdb.gz
6	AFDB:Q9YHZ5	0.846	0.849	2.113E-39	310	0.489	0.490	Q9YHZ5.pdb.gz	PIM2_DANRE Serine/threonine-protein kinase pim-2 OS=Danio rerio OX=7955 GN=pim2 PE=2 SV=2
7	AFDB:Q08BC0	0.835	0.812	7.684E-39	320	0.502	0.487	Q08BC0.pdb.gz	Q08BC0_DANRE Serine/threonine-protein kinase OS=Danio rerio OX=7955 GN=zgc:153997 PE=2 SV=1
8	PDB:7ooxA	0.804	0.875	3.735E-35	285	0.511	0.558	7ooxA.pdb.gz	Crystal Structure-Guided Design of Bisubstrate Inhibitors and Photoluminescent Probes for Protein Kinases of the PIM Family.
9	AFDB:Q20443	0.817	0.579	2.028E-32	441	0.370	0.261	Q20443.pdb.gz	PRK2_CAEEL Serine/threonine-protein kinase prk-2 OS=Caenorhabditis elegans OX=6239 GN=prk-2 PE=3 SV=2
10	AFDB:Q9UTH3	0.769	0.319	2.893E-24	775	0.302	0.121	Q9UTH3.pdb.gz	PPK6_SCHPO Serine/threonine-protein kinase ppk6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk6 PE=1 SV=2
11	AFDB:B9DFC1	0.747	0.461	9.919E-24	512	0.293	0.178	B9DFC1.pdb.gz	B9DFC1_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=At3g01090 PE=1 SV=1
12	AFDB:B4E0Y5	0.759	0.365	1.410E-23	672	0.299	0.138	B4E0Y5.pdb.gz	B4E0Y5_HUMAN cDNA FLJ56013, highly similar to NUAK family SNF1-like kinase 2 OS=Homo sapiens OX=9606 PE=2 SV=1
13	PDB:4zhxA	0.734	0.565	9.460E-22	409	0.251	0.191	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
14	PDB:7myjC	0.711	0.486	1.064E-21	465	0.260	0.174	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
15	PDB:4rewA	0.736	0.564	3.439E-21	411	0.260	0.197	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
16	PDB:4rerA	0.732	0.504	5.832E-21	459	0.264	0.179	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	PDB:6b1uA	0.706	0.503	1.491E-20	442	0.248	0.174	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
18	PDB:5ufuA	0.734	0.624	8.670E-20	369	0.251	0.211	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
19	PDB:5u6yA	0.696	0.481	8.060E-19	459	0.241	0.163	5u6yA.pdb.gz
20	PDB:4c0tA	0.702	0.748	1.019E-18	291	0.238	0.254	4c0tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q62070	0.0	568	370	0.894	0.751	PIM2_MOUSE Serine/threonine-protein kinase pim-2 OS=Mus musculus OX=10090 GN=Pim2 PE=1 SV=1
2	Q9P1W9	0.0	629	311	1.000	1.000	PIM2_HUMAN Serine/threonine-protein kinase pim-2 OS=Homo sapiens OX=9606 GN=PIM2 PE=1 SV=1
3	Q86V86	2.68e-117	342	326	0.566	0.540	PIM3_HUMAN Serine/threonine-protein kinase pim-3 OS=Homo sapiens OX=9606 GN=PIM3 PE=1 SV=3
4	P58750	1.69e-116	340	326	0.559	0.534	PIM3_MOUSE Serine/threonine-protein kinase pim-3 OS=Mus musculus OX=10090 GN=Pim3 PE=1 SV=1
5	O70444	5.74e-116	339	326	0.556	0.531	PIM3_RAT Serine/threonine-protein kinase pim-3 OS=Rattus norvegicus OX=10116 GN=Pim3 PE=1 SV=3
6	P11309	4.27e-115	336	313	0.547	0.543	PIM1_HUMAN Serine/threonine-protein kinase pim-1 OS=Homo sapiens OX=9606 GN=PIM1 PE=1 SV=4
7	P06803	1.00e-112	330	313	0.527	0.524	PIM1_MOUSE Serine/threonine-protein kinase pim-1 OS=Mus musculus OX=10090 GN=Pim1 PE=1 SV=3
8	Q08BC0	9.62e-110	323	320	0.502	0.487	Q08BC0_DANRE Serine/threonine-protein kinase OS=Danio rerio OX=7955 GN=zgc:153997 PE=2 SV=1
9	Q9YHZ5	9.98e-110	323	310	0.498	0.500	PIM2_DANRE Serine/threonine-protein kinase pim-2 OS=Danio rerio OX=7955 GN=pim2 PE=2 SV=2
10	Q20443	3.42e-67	218	441	0.360	0.254	PRK2_CAEEL Serine/threonine-protein kinase prk-2 OS=Caenorhabditis elegans OX=6239 GN=prk-2 PE=3 SV=2
11	Q9UTH3	5.71e-47	170	775	0.302	0.121	PPK6_SCHPO Serine/threonine-protein kinase ppk6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk6 PE=1 SV=2
12	Q08217	6.40e-45	165	1101	0.312	0.088	PSK2_YEAST Serine/threonine-protein kinase PSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSK2 PE=1 SV=1
13	Q38B72	1.48e-44	163	729	0.305	0.130	Q38B72_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1760 PE=4 SV=1
14	O22932	1.17e-41	151	435	0.293	0.209	CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana OX=3702 GN=CIPK11 PE=1 SV=1
15	O08679	1.45e-41	155	722	0.299	0.129	MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus OX=10116 GN=Mark2 PE=1 SV=1
16	E7ETY4	2.25e-41	154	763	0.299	0.122	E7ETY4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
17	E9PC69	3.00e-41	154	778	0.299	0.120	E9PC69_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=3
18	Q7KZI7	3.20e-41	154	788	0.299	0.118	MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
19	P31374	4.70e-41	154	1356	0.302	0.069	PSK1_YEAST Serine/threonine-protein kinase PSK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSK1 PE=1 SV=2
20	A0A8I6A623	1.34e-40	152	688	0.293	0.132	A0A8I6A623_RAT Microtubule affinity regulating kinase 4 OS=Rattus norvegicus OX=10116 GN=Mark4 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06293 Kdo	0.47	21.3	Lipopolysaccharide kinase (Kdo/WaaP) family
2	PF14531 Kinase-like	9.2e-06	36.8	Kinase-like
3	PF00069 Pkinase	7.9e-51	184.5	Protein kinase domain
4	PF17667 Pkinase_fungal	5.9e+02	10.6	Fungal protein kinase
5	PF07714 PK_Tyr_Ser-Thr	6.9e-18	76.4	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365692

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362608	0.830	Serine/threonine-protein kinase pim-1
2	9606.ENSP00000335153	0.708	Heat shock protein HSP 90-alpha
3	9606.ENSP00000357153	0.704	Antigen-presenting glycoprotein CD1d
4	9606.ENSP00000329418	0.603	Suppressor of cytokine signaling 1
5	9606.ENSP00000359417	0.567	Myotubularin-related protein 1
6	9606.ENSP00000258149	0.566	E3 ubiquitin-protein ligase Mdm2
7	9606.ENSP00000365694	0.561	Serine/threonine-protein phosphatase 1 regulatory subunit 10
8	9606.ENSP00000340691	0.529	Eukaryotic translation initiation factor 4E-binding protein 1
9	9606.ENSP00000479618	0.527	Myc proto-oncogene protein
10	9606.ENSP00000271526	0.513	Proline-rich protein PRCC

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0019538	0.991	protein metabolic process
GO:0043412	0.987	macromolecule modification
GO:0050794	0.986	regulation of cellular process
GO:0006796	0.981	phosphate-containing compound metabolic process
GO:0016310	0.972	phosphorylation
GO:0006468	0.948	protein phosphorylation
GO:0050896	0.935	response to stimulus
GO:0048518	0.853	positive regulation of biological process
GO:0019222	0.796	regulation of metabolic process
GO:0048522	0.792	positive regulation of cellular process
GO:0060255	0.728	regulation of macromolecule metabolic process
GO:0031323	0.667	regulation of cellular metabolic process
GO:0080090	0.648	regulation of primary metabolic process
GO:0051171	0.643	regulation of nitrogen compound metabolic process
GO:0051716	0.578	cellular response to stimulus
GO:0048523	0.483	negative regulation of cellular process
GO:0010468	0.428	regulation of gene expression
GO:0007154	0.407	cell communication
GO:0023052	0.403	signaling
GO:0009893	0.393	positive regulation of metabolic process
GO:0010604	0.384	positive regulation of macromolecule metabolic process
GO:0007165	0.375	signal transduction
GO:0065009	0.315	regulation of molecular function
GO:0042981	0.315	regulation of apoptotic process
GO:0009605	0.314	response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.998	nucleoplasm
GO:0043232	0.938	intracellular non-membrane-bounded organelle
GO:0016020	0.705	membrane
GO:0071944	0.308	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]