StarFunc result for job id Q9P1Y6

User Input

>input (1649 residues)
MDDDSLDELVARSPGPDGHPQVGPADPAGDFEESSVGSSGDSGDDSDSEHGDGTDGEDEG
ASEEEDLEDRSGSEDSEDDGETLLEVAGTQGKLEAAGSFNSDDDAESCPICLNAFRDQAV
GTPENCAHYFCLDCIVEWSKNANSCPVDRTLFKCICIRAQFGGKILRKIPVENTKASEEE
EDPTFCEVCGRSDREDRLLLCDGCDAGYHMECLDPPLQEVPVDEWFCPECAAPGVVLAAD
AGPVSEEEVSLLLADVVPTTSRLRPRAGRTRAIARTRQSERVRATVNRNRISTARRVQHT
PGRLGSSLLDEAIEAVATGLSTAVYQRPLTPRTPARRKRKTRRRKKVPGRKKTPSGPSAK
SKSSATRSKKRQHRVKKRRGKKVKSEATTRSRIARTLGLRRPVHSSCIPSVLKPVEPSLG
LLRADIGAASLSLFGDPYELDPFDSSEELSANPLSPLSAKRRALSRSALQSHQPVARPVS
VGLSRRRLPAAVPEPDLEEEPVPDLLGSILSGQSLLMLGSSDVIIHRDGSLSAKRAAPVS
FQRNSGSLSRGEEGFKGCLQPRALPSGSPAQGPSGNRPQSTGLSCQGRSRTPARTAGAPV
RLDLPAAPGAVQARNLSNGSVPGFRQSHSPWFNGTNKHTLPLASAASKISSRDSKPPCRS
VVPGPPLKPAPRRTDISELPRIPKIRRDDGGGRRDAAPAHGQSIEIPSACISRLTGREGT
GQPGRGTRAESEASSRVPREPGVHTGSSRPPAPSSHGSLAPLGPSRGKGVGSTFESFRIN
IPGNMAHSSQLSSPGFCNTFRPVDDKEQRKENPSPLFSIKKTKQLRSEVYDPSDPTGSDS
SAPGSSPERSGPGLLPSEITRTISINSPKAQTVQAVRCVTSYTVESIFGTEPEPPLGPSS
AMSKLRGAVAAEGASDTEREEPTESQGLAARLRRPSPPEPWDEEDGASCSTFFGSEERTV
TCVTVVEPEAPPSPDVLQAATHRVVELRPPSRSRSTSSSRSRKKAKRKRVSREHGRTRSG
TRSESRDRSSRSASPSVGEERPRRQRSKAKSRRSSSDRSSSRERAKRKKAKDKSREHRRG
PWGHSRRTSRSRSGSPGSSSYEHYESRKKKKRRSASRPRGRECSPTSSLERLCRHKHQRE
RSHERPDRKESVAWPRDRRKRRSRSPSSEHRAREHRRPRSREKWPQTRSHSPERKGAVRE
ASPAPLAQGEPGREDLPTRLPALGEAHVSPEVATADKAPLQAPPVLEVAAECEPDDLDLD
YGDSVEAGHVFDDFSSDAVFIQLDDMSSPPSPESTDSSPERDFPLKPALPPASLAVAAIQ
REVSLMHDEDPSQPPPLPEGTQEPHLLRPDAAEKAEAPSSPDVAPAGKEDSPSASGRVQE
AARPEEVVSQTPLLRSRALVKRVTWNLQESESSAPAEDRAPRAPLHRPQKPREGAWDMED
VAPTGVRQVFSELPFPSHVLPEPGFPDTDPSQVYSPGLPPAPAQPSSIPPCALVSQPTVQ
FILQGSLPLVGCGAAQTLAPVPAALTPASEPASQATAASNSEEKTPAPRLAAEKTKKEEY
MKKLHMQERAVEEVKLAIKPFYQKREVTKEEYKDILRKAVQKICHSKSGEINPVKVANLV
KAYVDKYRHMRRHKKPEAGEEPPTQGAEG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63625	0.161	0.160	0.000	1685	0.710	0.695	Q63625.pdb.gz	PHRF1_RAT PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Phrf1 PE=1 SV=2
2	AFDB:Q9P1Y6	1.000	1.000	0.000	1649	1.000	1.000	Q9P1Y6.pdb.gz	PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1 PE=1 SV=3
3	AFDB:Q9VNE0	0.094	0.071	2.036E-27	2296	0.271	0.195	Q9VNE0.pdb.gz	Q9VNE0_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2926 PE=1 SV=1
4	AFDB:Q99590	0.064	0.071	2.297E-18	1463	0.188	0.212	Q99590.pdb.gz	SCAFB_HUMAN Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2
5	AFDB:Q63624	0.055	0.069	8.879E-11	1258	0.183	0.239	Q63624.pdb.gz	SFR19_RAT Splicing factor, arginine/serine-rich 19 OS=Rattus norvegicus OX=10116 GN=Scaf1 PE=1 SV=2
6	AFDB:Q9H7N4	0.050	0.063	2.297E-9	1312	0.168	0.211	Q9H7N4.pdb.gz	SFR19_HUMAN Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3
7	AFDB:Q8C9B9	0.038	0.030	6.145E-6	2256	0.173	0.127	Q8C9B9.pdb.gz	DIDO1_MOUSE Death-inducer obliterator 1 OS=Mus musculus OX=10090 GN=Dido1 PE=1 SV=4
8	AFDB:Q9NS56	0.050	0.074	5.708E-5	1045	0.098	0.155	Q9NS56.pdb.gz	TOPRS_HUMAN E3 ubiquitin-protein ligase Topors OS=Homo sapiens OX=9606 GN=TOPORS PE=1 SV=1
9	AFDB:Q8IY92	0.044	0.041	1.327E-4	1834	0.179	0.161	Q8IY92.pdb.gz	SLX4_HUMAN Structure-specific endonuclease subunit SLX4 OS=Homo sapiens OX=9606 GN=SLX4 PE=1 SV=3
10	AFDB:Q80Z37	0.059	0.088	1.590E-4	1033	0.098	0.156	Q80Z37.pdb.gz	TOPRS_MOUSE E3 ubiquitin-protein ligase Topors OS=Mus musculus OX=10090 GN=Topors PE=1 SV=1
11	PDB:7oniR	0.034	0.513	6.658E-3	86	0.012	0.221	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
12	PDB:4a0cF	0.033	0.567	7.977E-3	80	0.012	0.250	4a0cF.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
13	PDB:4r8pL	0.033	0.192	2.661E-2	254	0.012	0.079	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
14	PDB:2lgvA	0.029	0.399	3.189E-2	100	0.011	0.180	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
15	PDB:5l9uB	0.032	0.535	5.824E-2	71	0.012	0.268	5l9uB.pdb.gz
16	PDB:8a3tU	0.033	0.351	5.824E-2	114	0.012	0.167	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
17	PDB:5gm6a	0.027	0.329	8.879E-2	123	0.007	0.098	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	PDB:4kfzB	0.035	0.210	2.192E-1	148	0.012	0.135	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
19	PDB:7dvq9	0.033	0.114	2.789E-1	409	0.023	0.093	7dvq9.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:7ddeA	0.024	0.070	7.313E-1	525	0.007	0.021	7ddeA.pdb.gz	Molecular and structural mechanisms of ZZ domain-mediated cargo selection by Nbr1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q63625	0.0	1909	1685	0.695	0.680	PHRF1_RAT PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Phrf1 PE=1 SV=2
2	Q9P1Y6	0.0	3282	1649	1.000	1.000	PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1 PE=1 SV=3
3	Q9VNE0	1.15e-39	164	2296	0.050	0.036	Q9VNE0_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2926 PE=1 SV=1
4	Q6NP07	1.77e-39	163	1489	0.050	0.056	Q6NP07_DROME LD08594p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG2926 PE=2 SV=1
5	A0A0B4KF97	5.88e-39	160	874	0.050	0.095	A0A0B4KF97_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2926 PE=4 SV=1
6	Q63624	1.17e-37	157	1258	0.050	0.065	SFR19_RAT Splicing factor, arginine/serine-rich 19 OS=Rattus norvegicus OX=10116 GN=Scaf1 PE=1 SV=2
7	Q9H7N4	7.91e-37	154	1312	0.052	0.065	SFR19_HUMAN Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3
8	F8VXG7	2.19e-27	124	1271	0.033	0.042	F8VXG7_HUMAN SR-related CTD associated factor 11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=1
9	Q99590	3.14e-27	123	1463	0.033	0.037	SCAFB_HUMAN Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2
10	O94400	6.85e-18	91.7	571	0.027	0.077	YQF7_SCHPO PHD and RING finger domain-containing protein C126.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC126.07c PE=4 SV=1
11	Q9BMQ0	2.21e-12	75.1	3109	0.018	0.009	Q9BMQ0_DROME Toutatis OS=Drosophila melanogaster OX=7227 GN=tou PE=3 SV=1
12	A8DYA3	2.40e-12	75.1	3131	0.018	0.009	A8DYA3_DROME Toutatis, isoform E OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
13	A0A0B4KEM1	2.46e-12	75.1	3094	0.018	0.009	A0A0B4KEM1_DROME Toutatis, isoform G OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
14	A0A0B4KFE3	2.48e-12	75.1	3058	0.018	0.009	A0A0B4KFE3_DROME Toutatis, isoform F OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
15	A0A3B3IT85	3.27e-12	72.0	316	0.019	0.098	A0A3B3IT85_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase (Fragment) OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
16	A0A096MJZ8	6.73e-12	73.6	1635	0.018	0.018	A0A096MJZ8_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=1 SV=1
17	A0A0G2K454	6.79e-12	73.6	1634	0.018	0.018	A0A0G2K454_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=1 SV=1
18	A0A8I5ZPK6	6.79e-12	73.6	1636	0.018	0.018	A0A8I5ZPK6_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=3 SV=1
19	P29375	7.63e-12	73.2	1690	0.018	0.017	KDM5A_HUMAN Lysine-specific demethylase 5A OS=Homo sapiens OX=9606 GN=KDM5A PE=1 SV=3
20	A0A0G2JTU9	9.01e-12	73.2	1553	0.018	0.019	A0A0G2JTU9_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00628 PHD	3.8e-10	50.8	PHD-finger
2	PF13831 PHD_2	2.3e+02	12.7	PHD-finger
3	PF00097 zf-C3HC4	0.0015	29.7	Zinc finger, C3HC4 type (RING finger)
4	PF13923 zf-C3HC4_2	0.0059	27.7	Zinc finger, C3HC4 type (RING finger)
5	PF13920 zf-C3HC4_3	1.3	20.3	Zinc finger, C3HC4 type (RING finger)
6	PF15227 zf-C3HC4_4	6.4e+02	11.9	zinc finger of C3HC4-type, RING
7	PF12678 zf-rbx1	1.9	20.1	RING-H2 zinc finger domain
8	PF16685 zf-RING_10	3.8e+02	12.6	zinc RING finger of MSL2
9	PF17123 zf-RING_11	5.6e+02	11.7	RING-like zinc finger
10	PF13639 zf-RING_2	2.1e-05	36.1	Ring finger domain
11	PF14634 zf-RING_5	3	19.2	zinc-RING finger domain
12	PF13445 zf-RING_UBOX	0.0022	29.3	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264555

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348472	0.709	PX domain-containing protein kinase-like protein
2	9606.ENSP00000380646	0.658	Transmembrane protein 80
3	9606.ENSP00000352516	0.651	DNA (cytosine-5)-methyltransferase 1
4	9606.ENSP00000320509	0.643	B-cell scaffold protein with ankyrin repeats
5	9606.ENSP00000284486	0.636	Protein FAM167A
6	9606.ENSP00000361363	0.605	DNA methyltransferase 1-associated protein 1
7	9606.ENSP00000266070	0.587	Death-inducer obliterator 1
8	9606.ENSP00000417378	0.586	ATPase H+ transporting V1 subunit F
9	9606.ENSP00000367030	0.581	tRNA (cytosine(38)-C(5))-methyltransferase
10	9606.ENSP00000349770	0.565	Interferon regulatory factor 5
11	9606.ENSP00000262419	0.561	KAT8 regulatory NSL complex subunit 1
12	9606.ENSP00000351118	0.556	Cadherin-related family member 5
13	9606.ENSP00000192788	0.518	UHRF1-binding protein 1
14	9606.ENSP00000259089	0.517	Tyrosine-protein kinase Blk
15	9606.ENSP00000262043	0.516	PHD finger protein 3
16	9606.ENSP00000270115	0.516	Leucine-rich repeat-containing protein 56
17	9606.ENSP00000479679	0.506	Enhances bone morphogenetic protein (BMP) signaling in a paracrine manner. In contrast, it inhibits both the activin-A and TGFB1-mediated signaling pathways (By similarity)
18	9606.ENSP00000416707	0.505	XK-related protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.976	enzyme binding
GO:0070063	0.924	RNA polymerase binding
GO:0019904	0.909	protein domain specific binding
GO:0003824	0.826	catalytic activity
GO:0016740	0.745	transferase activity
GO:0140096	0.515	catalytic activity, acting on a protein
GO:0097159	0.351	organic cyclic compound binding
GO:1901363	0.349	heterocyclic compound binding
GO:0003676	0.332	nucleic acid binding
GO:0019787	0.304	ubiquitin-like protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0090304	0.985	nucleic acid metabolic process
GO:0032774	0.969	RNA biosynthetic process
GO:0010467	0.962	gene expression
GO:0097659	0.953	nucleic acid-templated transcription
GO:0006351	0.921	DNA-templated transcription
GO:0065007	0.807	biological regulation
GO:0050789	0.800	regulation of biological process
GO:0050794	0.641	regulation of cellular process
GO:0006366	0.620	transcription by RNA polymerase II
GO:0006396	0.473	RNA processing
GO:0019222	0.428	regulation of metabolic process
GO:0016071	0.368	mRNA metabolic process
GO:0060255	0.366	regulation of macromolecule metabolic process
GO:0006397	0.359	mRNA processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.996	membrane
GO:0031981	0.908	nuclear lumen
GO:0005654	0.885	nucleoplasm
GO:0005737	0.348	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.745	Transferases.

[back to server]