StarFunc result for job id Q9P1Z0

User Input

>input (1013 residues)
MPPPAEVTDPSHAPAVLRQLNEQRLRGLFCDVTLIAGDTKFPAHRSVLAASSPFFREALL
TSAPLPLPPATGGAAPNPATTTAASSSSSSSSSSSSSSSSASSSSSSSSSSPPPASPPAS
SPPRVLELPGVPAAAFSDVLNFIYSARLALPGGGGDGAAVAEIGALGRRLGISRLQGLGE
GGDAWVPPTPAPMATSQPEEDSFGPGPRPAGEWEGDRAEAQAPDLQCSLPRRPLPCPQCG
KSFIHPKRLQTHEAQCRRGASTRGSTGLGAGGAGPGGPAGVDASALPPPVGFRGGPEHVV
KVVGGHVLYVCAACERSYVTLSSLKRHSNVHSWRRKYPCRYCEKVFALAEYRTKHEVWHT
GERRYQCIFCWETFVTYYNLKTHQRAFHGISPGLLASEKTPNGGYKPKLNTLKLYRLLPM
RAAKRPYKTYSQGAPEAPLSPTLNTPAPVAMPASPPPGPPPAPEPGPPPSVITFAHPAPS
VIVHGGSSSGGGGSGTASTGGSQAASVITYTAPPRPPKKREYPPPPPEPAATPTSPATAV
SPATAAGPAMATTTEEAKGRNPRAGRTLTYTAKPVGGIGGGGGPPTGAGRGPSQLQAPPP
LCQITVRIGEEAIVKRRISETDLRPGELSGEEMEESEEDEEEEDEEEEEEDEEESKAGGE
DQLWRPYYSYKPKRKAGAAGGASVGGSGLPRGRRPPRWRQKLERRSWEETPAAESPAGRA
RTERRHRCGDCAQTFTTLRKLRKHQEAHGGGSHSSRAGRRPSTRFTCPHCAKVCKTAAAL
SRHGQRHAAERPGGTPTPVIAYSKGSAGTRPGDVKEEAPQEMQVSSSSGEAGGGSTAAEE
ASETASLQDPIISGGEEPPVVASGGSYVYPPVQEFPLALIGGGREPGGGRGKSGSEGPVG
AGEGDRMEGIGAAKVTFYPEPYPLVYGPQLLAAYPYNFSNLAALPVALNMVLPDEKGAGA
LPFLPGVFGYAVNPQAAPPAPPTPPPPTLPPPIPPKGEGERAGVERTQKGDVG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P1Z0	0.999	0.999	0.000	1013	1.000	1.000	Q9P1Z0.pdb.gz	ZBTB4_HUMAN Zinc finger and BTB domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZBTB4 PE=1 SV=3
2	AFDB:Q5EXX3	0.091	0.082	9.018E-23	1203	0.297	0.250	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
3	AFDB:Q8VIG1	0.087	0.081	7.249E-10	1082	0.142	0.133	Q8VIG1.pdb.gz	REST_MOUSE RE1-silencing transcription factor OS=Mus musculus OX=10090 GN=Rest PE=1 SV=2
4	AFDB:Q13127	0.090	0.084	8.201E-10	1097	0.120	0.111	Q13127.pdb.gz	REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=3
5	AFDB:O54963	0.094	0.090	4.901E-9	1069	0.123	0.117	O54963.pdb.gz	REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus OX=10116 GN=Rest PE=1 SV=1
6	AFDB:A2A935	0.091	0.077	2.435E-8	1275	0.168	0.133	A2A935.pdb.gz	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
7	AFDB:Q92766	0.090	0.057	5.102E-8	1687	0.205	0.123	Q92766.pdb.gz	RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3
8	AFDB:O75362	0.049	0.048	1.646E-7	1048	0.147	0.142	O75362.pdb.gz	ZN217_HUMAN Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1
9	AFDB:Q9H0D2	0.092	0.070	2.383E-7	1346	0.156	0.117	Q9H0D2.pdb.gz	ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens OX=9606 GN=ZNF541 PE=1 SV=3
10	AFDB:Q9Y2X9	0.086	0.096	4.150E-7	895	0.128	0.145	Q9Y2X9.pdb.gz	ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens OX=9606 GN=ZNF281 PE=1 SV=1
11	PDB:6wcqC	0.099	0.718	2.136E-4	130	0.027	0.208	6wcqC.pdb.gz
12	PDB:3w5kB	0.060	0.288	8.115E-3	110	0.023	0.209	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
13	PDB:7mk2A	0.096	0.256	8.631E-3	354	0.031	0.088	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
14	PDB:6sgaFS	0.045	0.149	1.058	277	0.013	0.047	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
15	PDB:6gypD	0.043	0.271	1.354	151	0.012	0.079	6gypD.pdb.gz	Architecture of the CBF3-centromere complex of the budding yeast kinetochore.
16	PDB:3gn5A	0.025	0.105	1.531	132	0.012	0.091	3gn5A.pdb.gz	Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
17	PDB:5apny	0.033	0.108	1.531	211	0.020	0.095	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
18	PDB:1yw5A	0.027	0.120	1.629	177	0.011	0.062	1yw5A.pdb.gz
19	PDB:5xylA	0.042	0.242	1.843	163	0.012	0.074	5xylA.pdb.gz
20	PDB:7pmkK	0.046	0.294	2.084	137	0.010	0.073	7pmkK.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P1Z0	0.0	1997	1013	1.000	1.000	ZBTB4_HUMAN Zinc finger and BTB domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZBTB4 PE=1 SV=3
2	A0A0R4INF0	1.95e-82	295	1570	0.148	0.096	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
3	Q5EXX3	1.07e-75	273	1203	0.221	0.186	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
4	A0A1B0GV48	1.18e-65	237	725	0.114	0.159	A0A1B0GV48_HUMAN Zinc finger and BTB domain containing 38 (Fragment) OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=1
5	D6RBC4	1.46e-65	238	771	0.114	0.149	D6RBC4_HUMAN Zinc finger and BTB domain containing 38 (Fragment) OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=1
6	Q8NAP3	4.95e-63	235	1195	0.114	0.096	ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2
7	Q86T24	1.26e-36	150	672	0.066	0.100	KAISO_HUMAN Transcriptional regulator Kaiso OS=Homo sapiens OX=9606 GN=ZBTB33 PE=1 SV=2
8	Q8UVQ4	1.26e-36	150	701	0.068	0.098	KAISO_XENLA Transcriptional regulator Kaiso OS=Xenopus laevis OX=8355 GN=zbtb33 PE=1 SV=2
9	Q8BN78	1.41e-35	147	671	0.063	0.095	KAISO_MOUSE Transcriptional regulator Kaiso OS=Mus musculus OX=10090 GN=Zbtb33 PE=1 SV=1
10	I7HJS4	3.71e-17	87.8	458	0.062	0.138	ZN683_MOUSE Tissue-resident T-cell transcription regulator protein ZNF683 OS=Mus musculus OX=10090 GN=Znf683 PE=2 SV=1
11	A0A1Y7VLS7	3.56e-14	77.0	312	0.054	0.176	A0A1Y7VLS7_MOUSE Pluripotency associated transcript 25 OS=Mus musculus OX=10090 GN=Platr25 PE=4 SV=1
12	Q93560	3.75e-14	79.3	817	0.043	0.054	BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=blmp-1 PE=1 SV=1
13	Q3UT31	9.80e-14	75.5	312	0.053	0.173	Q3UT31_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Platr25 PE=2 SV=1
14	P0CH99	1.02e-13	75.5	300	0.031	0.103	Z705D_HUMAN Zinc finger protein 705D OS=Homo sapiens OX=9606 GN=ZNF705D PE=1 SV=1
15	Q9UDV7	1.35e-13	77.4	671	0.035	0.052	ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens OX=9606 GN=ZNF282 PE=1 SV=3
16	O43829	1.86e-13	76.3	449	0.094	0.212	ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZBTB14 PE=1 SV=2
17	Q6AZW8	2.16e-13	74.7	331	0.055	0.169	ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens OX=9606 GN=ZNF660 PE=1 SV=1
18	Q8CIP9	2.64e-13	73.6	271	0.031	0.114	Q8CIP9_MOUSE KRAB zinc finger protein 6D (Fragment) OS=Mus musculus OX=10090 GN=Zfp640 PE=2 SV=1
19	Q9VRN4	3.76e-13	76.6	1203	0.046	0.039	Q9VRN4_DROME Blimp-1, isoform A OS=Drosophila melanogaster OX=7227 GN=Blimp-1 PE=2 SV=1
20	Q8TD17	4.52e-13	75.9	642	0.052	0.083	ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens OX=9606 GN=ZNF398 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	6.2e-11	53.9	BTB/POZ domain
2	PF14851 FAM176	4.8e+02	11.9	FAM176 family
3	PF10156 Med17	5.9e+02	10.5	Subunit 17 of Mediator complex
4	PF00096 zf-C2H2	5.8e-12	56.5	Zinc finger, C2H2 type
5	PF13894 zf-C2H2_4	1.1e-06	40.0	C2H2-type zinc finger
6	PF13913 zf-C2HC_2	11	17.2	zinc-finger of a C2HC-type
7	PF13465 zf-H2C2_2	0.0018	29.8	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307858

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000446880	0.633	Bromodomain adjacent to zinc finger domain protein 2A
2	9606.ENSP00000276893	0.622	E3 ubiquitin-protein ligase UHRF2
3	9606.ENSP00000298854	0.608	43 kDa receptor-associated protein of the synapse
4	9606.ENSP00000302111	0.606	Methylated-DNA--protein-cysteine methyltransferase
5	9606.ENSP00000307134	0.584	Catenin delta-2
6	9606.ENSP00000263207	0.565	Armadillo repeat protein deleted in velo-cardio-facial syndrome
7	9606.ENSP00000479617	0.555	E3 ubiquitin-protein ligase UHRF1
8	9606.ENSP00000374409	0.545	Plakophilin-4
9	9606.ENSP00000395535	0.524	Methyl-CpG-binding protein 2
10	9606.ENSP00000382004	0.516	Catenin delta-1
11	9606.ENSP00000385571	0.512	Homeodomain-interacting protein kinase 2
12	9606.ENSP00000446205	0.502	Transcription factor HES-7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0000981	0.996	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.996	transcription cis-regulatory region binding
GO:0001227	0.994	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000977	0.993	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0008327	0.988	methyl-CpG binding
GO:0019899	0.927	enzyme binding
GO:0042802	0.897	identical protein binding
GO:0042803	0.874	protein homodimerization activity
GO:0019900	0.847	kinase binding
GO:0019901	0.844	protein kinase binding
GO:0010428	0.529	methyl-CpNpG binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0009987	0.992	cellular process
GO:0051171	0.991	regulation of nitrogen compound metabolic process
GO:0080090	0.989	regulation of primary metabolic process
GO:0006355	0.982	regulation of DNA-templated transcription
GO:0051172	0.970	negative regulation of nitrogen compound metabolic process
GO:0010605	0.968	negative regulation of macromolecule metabolic process
GO:0031327	0.966	negative regulation of cellular biosynthetic process
GO:0045892	0.962	negative regulation of DNA-templated transcription
GO:0051716	0.960	cellular response to stimulus
GO:0000122	0.917	negative regulation of transcription by RNA polymerase II
GO:0006974	0.912	cellular response to DNA damage stimulus
GO:0048518	0.310	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.989	cytosol
GO:0043228	0.921	non-membrane-bounded organelle
GO:0016604	0.680	nuclear body
GO:0043232	0.481	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]