StarFunc result for job id Q9P1Z2

User Input

>input (691 residues)
MEESPLSRAPSRGGVNFLNVARTYIPNTKVECHYTLPPGTMPSASDWIGIFKVEAACVRD
YHTFVWSSVPESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFRE
PRPMDELVTLEEADGGSDILLVVPKATVLQNQLDESQQERNDLMQLKLQLEGQVTELRSR
VQELERALATARQEHTELMEQYKGISRSHGEITEERDILSRQQGDHVARILELEDDIQTI
SEKVLTKEVELDRLRDTVKALTREQEKLLGQLKEVQADKEQSEAELQVAQQENHHLNLDL
KEAKSWQEEQSAQAQRLKDKVAQMKDTLGQAQQRVAELEPLKEQLRGAQELAASSQQKAT
LLGEELASAAAARDRTIAELHRSRLEVAEVNGRLAELGLHLKEEKCQWSKERAGLLQSVE
AEKDKILKLSAEILRLEKAVQEERTQNQVFKTELAREKDSSLVQLSESKRELTELRSALR
VLQKEKEQLQEEKQELLEYMRKLEARLEKVADEKWNEDATTEDEEAAVGLSCPAALTDSE
DESPEDMRLPPYGLCERGDPGSSPAGPREASPLVVISQPAPISPHLSGPAEDSSSDSEAE
DEKSVLMAAVQSGGEEANLLLPELGSAFYDMASGFTVGTLSETSTGGPATPTWKECPICK
ERFPAESDKDALEDHMDGHFFFSTQDPFTFE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RAZ1	0.388	0.388	4.105E-81	691	1.000	1.000	A0A024RAZ1.pdb.gz
2	AFDB:Q8CGU1	0.595	0.595	7.127E-79	691	0.891	0.891	Q8CGU1.pdb.gz	CACO1_MOUSE Calcium-binding and coiled-coil domain-containing protein 1 OS=Mus musculus OX=10090 GN=Calcoco1 PE=1 SV=2
3	AFDB:Q86VP1	0.469	0.419	1.174E-28	789	0.292	0.256	Q86VP1.pdb.gz	TAXB1_HUMAN Tax1-binding protein 1 OS=Homo sapiens OX=9606 GN=TAX1BP1 PE=1 SV=2
4	AFDB:Q3UKC1	0.417	0.362	3.911E-28	814	0.292	0.248	Q3UKC1.pdb.gz	TAXB1_MOUSE Tax1-binding protein 1 homolog OS=Mus musculus OX=10090 GN=Tax1bp1 PE=1 SV=2
5	AFDB:Q9I8F3	0.358	0.441	1.761E-23	539	0.229	0.293	Q9I8F3.pdb.gz	Q9I8F3_CHICK Muscle-derived protein 62 OS=Gallus gallus OX=9031 GN=MDP62 PE=2 SV=1
6	AFDB:Q13137	0.165	0.238	6.328E-14	446	0.205	0.318	Q13137.pdb.gz	CACO2_HUMAN Calcium-binding and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CALCOCO2 PE=1 SV=1
7	AFDB:P32618	0.110	0.083	7.576E-4	956	0.140	0.101	P32618.pdb.gz	YEF3_YEAST Uncharacterized protein YEL043W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YEL043W PE=1 SV=1
8	AFDB:Q38DW1	0.200	0.192	1.690E-3	726	0.159	0.152	Q38DW1.pdb.gz	Q38DW1_TRYB2 Spindle assembly abnormal protein 6 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1930 PE=4 SV=1
9	PDB:7tvzE	0.103	0.106	2.172E-3	665	0.019	0.020	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
10	AFDB:Q8CIS0	0.151	0.094	2.524E-3	1159	0.137	0.082	Q8CIS0.pdb.gz	CAR11_MOUSE Caspase recruitment domain-containing protein 11 OS=Mus musculus OX=10090 GN=Card11 PE=1 SV=2
11	AFDB:Q5F3W0	0.176	0.116	4.740E-3	1170	0.139	0.082	Q5F3W0.pdb.gz	Q5F3W0_CHICK CARD domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_5k17 PE=2 SV=1
12	PDB:3lxuX	0.091	0.057	5.433E-3	1217	0.022	0.012	3lxuX.pdb.gz
13	PDB:4aizA	0.099	0.395	1.144E-2	107	0.017	0.112	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.
14	PDB:3oaiA	0.098	0.132	1.524E-2	488	0.019	0.027	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
15	PDB:5ir3A	0.109	0.469	1.810E-2	111	0.020	0.126	5ir3A.pdb.gz
16	PDB:6xreM	0.106	0.209	1.917E-2	314	0.020	0.045	6xreM.pdb.gz	Structure of the p53/RNA polymerase II assembly.
17	PDB:5dcaA	0.114	0.045	2.030E-2	1948	0.022	0.008	5dcaA.pdb.gz
18	PDB:4lnvA	0.123	0.071	2.149E-2	1276	0.022	0.012	4lnvA.pdb.gz
19	PDB:1ogpA	0.116	0.191	2.276E-2	388	0.016	0.028	1ogpA.pdb.gz	The Crystal Structure of Plant Sulfite Oxidase Provides Insights Into Sulfite Oxidation in Plants and Animals
20	PDB:4y5xB	0.092	0.367	2.410E-2	111	0.012	0.072	4y5xB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CGU1	0.0	1248	691	0.893	0.893	CACO1_MOUSE Calcium-binding and coiled-coil domain-containing protein 1 OS=Mus musculus OX=10090 GN=Calcoco1 PE=1 SV=2
2	Q9P1Z2	0.0	1403	691	1.000	1.000	CACO1_HUMAN Calcium-binding and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CALCOCO1 PE=1 SV=2
3	Q9I8F3	1.46e-74	252	539	0.203	0.260	Q9I8F3_CHICK Muscle-derived protein 62 OS=Gallus gallus OX=9031 GN=MDP62 PE=2 SV=1
4	Q86VP1	2.98e-73	254	789	0.216	0.189	TAXB1_HUMAN Tax1-binding protein 1 OS=Homo sapiens OX=9606 GN=TAX1BP1 PE=1 SV=2
5	Q66HA4	1.08e-66	236	813	0.205	0.175	TAXB1_RAT Tax1-binding protein 1 homolog OS=Rattus norvegicus OX=10116 GN=Tax1bp1 PE=2 SV=1
6	Q3UKC1	1.87e-66	236	814	0.198	0.168	TAXB1_MOUSE Tax1-binding protein 1 homolog OS=Mus musculus OX=10090 GN=Tax1bp1 PE=1 SV=2
7	Q13137	3.51e-28	120	446	0.142	0.220	CACO2_HUMAN Calcium-binding and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CALCOCO2 PE=1 SV=1
8	D6REB0	2.81e-10	63.9	259	0.107	0.286	D6REB0_HUMAN Calcium binding and coiled-coil domain 2 (Fragment) OS=Homo sapiens OX=9606 GN=CALCOCO2 PE=1 SV=1
9	Q54QH4	0.001	44.7	905	0.075	0.057	Q54QH4_DICDI WASP-related protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0283827 PE=4 SV=1
10	P34216	0.007	42.4	1381	0.067	0.033	EDE1_YEAST EH domain-containing and endocytosis protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EDE1 PE=1 SV=2
11	M9PBF6	0.011	41.6	1088	0.097	0.062	M9PBF6_DROME Dynamin associated protein 160, isoform G OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
12	O61618	0.012	41.6	1094	0.097	0.061	O61618_DROME Dynamin associated protein isoform Dap160-1 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
13	Q9VIF7	0.012	41.6	1097	0.097	0.061	Q9VIF7_DROME Dynamin associated protein 160, isoform A OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
14	Q1WWC9	0.014	41.2	1096	0.097	0.061	Q1WWC9_DROME Dynamin associated protein 160, isoform C OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
15	M9ND00	0.015	41.2	1190	0.097	0.056	M9ND00_DROME Dynamin associated protein 160, isoform D OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
16	M9PDC7	0.016	41.2	1005	0.097	0.067	M9PDC7_DROME Dynamin associated protein 160, isoform H OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
17	A0A0G2K1V4	0.017	41.2	1937	0.103	0.037	A0A0G2K1V4_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
18	F1LRV9	0.019	40.8	1943	0.103	0.037	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3
19	O61639	0.019	40.8	1011	0.097	0.066	O61639_DROME Dynamin associated protein isoform Dap160-2 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
20	Q8INU2	0.019	40.8	1014	0.097	0.066	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07888 CALCOCO1	7.6e-179	607.4	Calcium binding and coiled-coil domain (CALCOCO1) like
2	PF19220 Crescentin	4.5e+02	11.2	Crescentin protein
3	PF05266 DUF724	43	15.4	Protein of unknown function (DUF724)
4	PF04745 Pox_A8	1.4e+02	13.0	VITF-3 subunit protein
5	PF04508 Pox_A_type_inc	3.3e+02	12.6	Viral A-type inclusion protein repeat
6	PF17751 SKICH	4.6e-24	96.3	SKICH domain
7	PF09454 Vps23_core	1.9e+02	13.5	Vps23 core domain
8	PF18112 Zn-C2H2_12	1.4e-09	49.4	Autophagy receptor zinc finger-C2H2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000449960

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000399968	0.913	Nuclear receptor coactivator 2
2	9606.ENSP00000405330	0.913	Estrogen receptor
3	9606.ENSP00000352821	0.758	Probable palmitoyltransferase ZDHHC14
4	9606.ENSP00000351407	0.741	Aryl hydrocarbon receptor nuclear translocator
5	9606.ENSP00000468354	0.586	Ankyrin repeat domain-containing protein 29
6	9606.ENSP00000477841	0.578	Zinc finger protein 282
7	9606.ENSP00000457206	0.556	SPRY domain-containing SOCS box protein 3
8	9606.ENSP00000263253	0.550	Histone acetyltransferase p300
9	9606.ENSP00000428402	0.544	Clavesin-1
10	9606.ENSP00000373572	0.522	Forkhead box protein I2
11	9606.ENSP00000352282	0.516	Kelch domain containing 1
12	9606.ENSP00000368389	0.514	Neugrin
13	9606.ENSP00000354483	0.505	Inactive dual specificity phosphatase 27

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity
GO:0003682	0.894	chromatin binding
GO:1901363	0.410	heterocyclic compound binding
GO:0097159	0.409	organic cyclic compound binding
GO:0003676	0.384	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0010604	0.985	positive regulation of macromolecule metabolic process
GO:0031323	0.983	regulation of cellular metabolic process
GO:0009891	0.978	positive regulation of biosynthetic process
GO:0051173	0.965	positive regulation of nitrogen compound metabolic process
GO:0010468	0.961	regulation of gene expression
GO:0031326	0.961	regulation of cellular biosynthetic process
GO:0031325	0.961	positive regulation of cellular metabolic process
GO:0080090	0.956	regulation of primary metabolic process
GO:0010557	0.950	positive regulation of macromolecule biosynthetic process
GO:0045893	0.937	positive regulation of DNA-templated transcription
GO:0009987	0.880	cellular process
GO:0050896	0.685	response to stimulus
GO:0051716	0.541	cellular response to stimulus
GO:0006357	0.492	regulation of transcription by RNA polymerase II
GO:0045944	0.423	positive regulation of transcription by RNA polymerase II
GO:0007154	0.384	cell communication
GO:0007165	0.313	signal transduction
GO:0010628	0.303	positive regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.996	cytosol
GO:0005634	0.939	nucleus
GO:0043232	0.716	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]