StarFunc result for job id Q9P1Z9

User Input

>input (1701 residues)
MRGGENRPPARVQSSSEELELRHQSLDAFPGRRLPGRGIQPAAKMSSVGKVTQVPNGKAY
QQIFQAEVQLVHSLAATRKRAAERSVTLKSGRIPMMKKVETPEGEVMSPRQQKWMHSLPN
DWIMENPVLHREKERAKREKARESENTIAAREVRGLMDTIVPEKISTSTFQRQAEHKRKS
YESALASFQEEIAQVGKEMEPLIVDTGGLFLKKLTESDEEMNRLFLKVENDTNLEDYTIQ
ALLELWDKVAGRLLLRKQEIKELDEALHSLEFSRTDKLKSVLKKYAEVIEKTSYLMRPEV
YRLINEEAMVMNYALLGNRKALAQLFVNLMESTLQQELDSRHRWQGLVDTWKALKKEALL
QSFSEFMASESIHTPPAVTKELEVMLKTQNVLQQRRLKHLCTICDLLPPSYSKTQLTEWH
SSLNSLNKELDTYHVDCMMRIRLLYEKTWQECLMHVQNCKKQLLDWKAFTEEEAETLVNQ
FFFQMVGALQGKVEEDLELLDKSFETLADQTEWQSSHLFKYFQEVVQLWEAHQSELLVQE
LELEKRMEQHRQKHSLESQVQEAHLDRLLDQLRQQSDKETLAFHLEKVKDYLKNMKSRYE
CFHTLLTKEVMEYPAIMLKELNSYSSALSQYFFVREIFEQNLAGEVIFKFRQPEAHEKPS
QKRVKKLRKKQGSKEDMTRSEESISSGTSTARSVEEVEEENDQEMESFITEEVLGQQKKS
PLHAKMDESKEGSIQGLEEMQVEREGSLNPSLNEENVKGQGEKKEESEEEDEKEEEEEEE
KLEEEKEEKEAQEEQESLSVGEEEDKEEGLEEIYYEDMESFTISSGNTYFVFVPLEEEHC
RKSHSTFSAMFINDTSSAKFIEQVTIPSRLILEIKKQLRAGFFEHLEKWFDQCSLNTRVT
VATKINELDSELELHLHLHQPRAQQIEKDIHNVRAAELLLHQEQLDSHCAGVTETLKKKR
LMFCQFQEEQNVRSKNFRLKIYDMEHIFLNATRSQKLVTLSNTLHQELLSYVDVTQVSLR
SFRQYLEESLGKLRYSNIEFIKHCRLFSEGGNFSPKEINSLCSRLEKEAARIELVESVIM
LNMEKLENEYLDQANDVINKFESKFHNLSVDLIFIEKIQRLLTNLQVKIKCQVAKSNSQT
NGLNFSLQQLQNKIKTCQESRGEKTTVTTEELLSFVQTWKEKLSQRIQYLNCSLDRVSMT
ELVFTNTILKDQEEDSDILTSSEALEEEAKLDVVTPESFTQLSRVGKPLIEDPAVDVIRK
LLQLPNTKWPTHHCDKDPSQTGRGAWACGSRGSSEAGAGGAVCSPPVLCSCPGPSSPKGF
KRHRCQPENSGKKAVPSASATSAGSFTPHPKPNKMERKYRVLGDKPPPAAEDFKGIILTL
LWESSENLLTVAEEFYRKEKRPVTRPDCMCDTFDQCAENISKKILEYQSQANKYHNSCLI
ELRIQIRRFEELLPQVCWLVMENFKEHHWKKFFTSVKEIRGQFEEQQKRLEKRKDKNAQK
LHLNLGHPVHFQEMESLHLSEEERQEELDSMIRMNKEKLEECTRRNGQVFITNLATFTEK
FLLQLDEVVTIDDVQVARMEPPKQKLSMLIRRKLAGLSLKEESEKPLIERGSRKWPGIKP
TEVTIQNKILLQPTSSISTTKTTLGHLAAVEARDAVYLKYLASFEEELKRIQDDCTSQIK
EAQRWKDSWKQSLHTIQGLYV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P1Z9	1.000	1.000	0.000	1701	1.000	1.000	Q9P1Z9.pdb.gz	CC180_HUMAN Coiled-coil domain-containing protein 180 OS=Homo sapiens OX=9606 GN=CCDC180 PE=2 SV=3
2	AFDB:P85120	0.048	0.041	2.900E-3	2058	0.115	0.095	P85120.pdb.gz	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1
3	AFDB:Q5SNZ0	0.053	0.049	1.651E-1	1873	0.116	0.106	Q5SNZ0.pdb.gz	GRDN_MOUSE Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV=2
4	AFDB:O94964	0.047	0.053	4.154E-1	1423	0.101	0.121	O94964.pdb.gz	SOGA1_HUMAN Protein SOGA1 OS=Homo sapiens OX=9606 GN=SOGA1 PE=1 SV=2
5	AFDB:F4JXK3	0.045	0.068	7.037E-1	1018	0.106	0.177	F4JXK3.pdb.gz	F4JXK3_ARATH Branched-chain amino acid aminotransferase 5 / branched-chain amino acid transaminase 5 (BCAT5) OS=Arabidopsis thaliana OX=3702 GN=ATBCAT-5 PE=1 SV=1
6	AFDB:Q9VWN9	0.044	0.039	8.029E-1	2103	0.098	0.079	Q9VWN9.pdb.gz	ZSWM8_DROME Zinc finger SWIM domain-containing protein 8 homolog OS=Drosophila melanogaster OX=7227 GN=Dora PE=2 SV=2
7	PDB:7nj1A	0.033	0.037	8.593E-1	1448	0.033	0.039	7nj1A.pdb.gz
8	PDB:5mpbP	0.031	0.077	1.169	440	0.034	0.130	5mpbP.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
9	AFDB:Q6IE81	0.056	0.094	1.360	842	0.032	0.064	Q6IE81.pdb.gz	JADE1_HUMAN Protein Jade-1 OS=Homo sapiens OX=9606 GN=JADE1 PE=1 SV=1
10	PDB:7owgB	0.031	0.026	2.069	2152	0.028	0.022	7owgB.pdb.gz
11	AFDB:Q9LD55	0.045	0.069	2.111	987	0.088	0.152	Q9LD55.pdb.gz	EIF3A_ARATH Eukaryotic translation initiation factor 3 subunit A OS=Arabidopsis thaliana OX=3702 GN=TIF3A1 PE=1 SV=1
12	PDB:5w5iC	0.029	0.069	2.162	436	0.031	0.122	5w5iC.pdb.gz	Structural insights into IFIT1 dimerization and conformational changes associated with mRNA binding
13	PDB:5y88I	0.031	0.072	2.259	541	0.036	0.115	5y88I.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
14	PDB:5dseA	0.033	0.081	2.360	537	0.031	0.099	5dseA.pdb.gz
15	PDB:6exnT	0.035	0.067	2.693	594	0.043	0.123	6exnT.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
16	AFDB:P06180	0.038	0.094	2.747	590	0.042	0.122	P06180.pdb.gz	HIBN_XENLA Histone-binding protein N1/N2 OS=Xenopus laevis OX=8355 PE=1 SV=3
17	AFDB:Q5F3W0	0.042	0.058	2.871	1170	0.041	0.060	Q5F3W0.pdb.gz	Q5F3W0_CHICK CARD domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_5k17 PE=2 SV=1
18	PDB:5yqgC	0.029	0.141	2.940	237	0.013	0.093	5yqgC.pdb.gz	Structural determinants controlling 14-3-3 recruitment to the endocytic adaptor Numb and dissociation of the Numb/alpha-adaptin complex.
19	PDB:7sszA	0.029	0.091	2.940	362	0.021	0.099	7sszA.pdb.gz
20	PDB:6iczJ	0.028	0.061	3.210	571	0.042	0.126	6iczJ.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P1Z9	0.0	3495	1701	1.000	1.000	CC180_HUMAN Coiled-coil domain-containing protein 180 OS=Homo sapiens OX=9606 GN=CCDC180 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14643 DUF4455	1.2e-187	635.9	Domain of unknown function (DUF4455)
2	PF14644 DUF4456	1e-64	229.8	Domain of unknown function (DUF4456)
3	PF14465 NFRKB_winged	7.5e+02	11.8	NFRKB Winged Helix-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000434727

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347444	0.910	Tudor domain-containing protein 7
2	9606.ENSP00000261211	0.830	Cyclin-dependent kinase 17
3	9606.ENSP00000383911	0.681	Ubiquitin-associated domain-containing protein 2
4	9606.ENSP00000387164	0.681	Probable serine carboxypeptidase CPVL
5	9606.ENSP00000220597	0.653	Phosphoprotein associated with glycosphingolipid-enriched microdomains 1
6	9606.ENSP00000256925	0.630	CDK5 and ABL1 enzyme substrate 1
7	9606.ENSP00000308597	0.628	Deleted in lung and esophageal cancer protein 1
8	9606.ENSP00000284273	0.614	Ubiquitin-associated and SH3 domain-containing protein B
9	9606.ENSP00000387262	0.610	MICOS complex subunit MIC60
10	9606.ENSP00000423665	0.604	Cyclin-dependent kinase 18
11	9606.ENSP00000328054	0.595	Putative coiled-coil domain-containing protein 144 N-terminal-like
12	9606.ENSP00000429367	0.558	Protein FAM92A
13	9606.ENSP00000467740	0.558	Ankyrin repeat domain-containing protein 62
14	9606.ENSP00000482374	0.517	Proline-rich protein 36
15	9606.ENSP00000359464	0.514	Opioid growth factor receptor like 1
16	9606.ENSP00000349305	0.513	Golgin subfamily A member 4
17	9606.ENSP00000357575	0.512	Cilia- and flagella-associated protein 46
18	9606.ENSP00000368876	0.512	TOG array regulator of axonemal microtubules protein 2
19	9606.ENSP00000325905	0.504	Serine/arginine-rich splicing factor 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0016043	0.877	cellular component organization
GO:0044782	0.844	cilium organization
GO:0048870	0.714	cell motility
GO:0060271	0.674	cilium assembly
GO:0032501	0.586	multicellular organismal process
GO:0000003	0.580	reproduction
GO:0032502	0.551	developmental process
GO:0007017	0.516	microtubule-based process
GO:0050789	0.382	regulation of biological process
GO:0050794	0.334	regulation of cellular process
GO:0048856	0.310	anatomical structure development
GO:0060285	0.300	cilium-dependent cell motility
GO:0001578	0.300	microtubule bundle formation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070062	0.999	extracellular exosome
GO:0005622	0.958	intracellular anatomical structure
GO:0005737	0.947	cytoplasm
GO:0043229	0.933	intracellular organelle
GO:0043231	0.727	intracellular membrane-bounded organelle
GO:0016020	0.390	membrane
GO:0071944	0.379	cell periphery
GO:0005634	0.360	nucleus
GO:0043232	0.300	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]