StarFunc result for job id Q9P202

User Input

>input (907 residues)
MNAPLDGLSVSSSSTGSLGSAAGAGGGGGAGLRLLSANVRQLHQALTALLSEAEREQFTH
CLNAYHARRNVFDLVRTLRVLLDSPVKRRLLPMLRLVIPRSDQLLFDQYTAEGLYLPATT
PYRQPAWGGPDSAGPGEVRLVSLRRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKE
GLRVGDQILRVNDKSLARVTHAEAVKALKGSKKLVLSVYSAGRIPGGYVTNHIYTWVDPQ
GRSISPPSGLPQPHGGALRQQEGDRRSTLHLLQGGDEKKVNLVLGDGRSLGLTIRGGAEY
GLGIYITGVDPGSEAEGSGLKVGDQILEVNGRSFLNILHDEAVRLLKSSRHLILTVKDVG
RLPHARTTVDETKWIASSRIRETMANSAGFLGDLTTEGINKPGFYKGPAGSQVTLSSLGN
QTRVLLEEQARHLLNEQEHATMAYYLDEYRGGSVSVEALVMALFKLLNTHAKFSLLSEVR
GTISPQDLERFDHLVLRREIESMKARQPPGPGAGDTYSMVSYSDTGSSTGSHGTSTTVSS
ARNTLDLEETGEAVQGNINALPDVSVDDVRSTSQGLSSFKPLPRPPPLAQGNDLPLGQPR
KLGREDLQPPSSMPSCSGTVFSAPQNRSPPAGTAPTPGTSSAQDLPSSPIYASVSPANPS
SKRPLDAHLALVNQHPIGPFPRVQSPPHLKSPSAEATVAGGCLLPPSPSGHPDQTGTNQH
FVMVEVHRPDSEPDVNEVRALPQTRTASTLSQLSDSGQTLSEDSGVDAGEAEASAPGRGR
QSVSTKSRSSKELPRNERPTDGANKPPGLLEPTSTLVRVKKSAATLGIAIEGGANTRQPL
PRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKTKDRDYIDFLV
TEFNVML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q810W9	0.562	0.556	0.000	920	0.878	0.865	Q810W9.pdb.gz	WHRN_RAT Whirlin OS=Rattus norvegicus OX=10116 GN=Whrn PE=1 SV=1
2	AFDB:Q9P202	1.000	1.000	0.000	907	1.000	1.000	Q9P202.pdb.gz	WHRN_HUMAN Whirlin OS=Homo sapiens OX=9606 GN=WHRN PE=1 SV=4
3	PDB:2xkxA	0.086	0.108	1.859E-9	721	0.072	0.090	2xkxA.pdb.gz
4	PDB:7pc5A	0.098	0.216	1.309E-7	405	0.032	0.072	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
5	PDB:7qqnC	0.092	0.196	6.146E-7	414	0.031	0.068	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
6	PDB:7p70A	0.091	0.201	1.129E-6	407	0.052	0.115	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
7	AFDB:A0A061I5T4	0.093	0.091	2.082E-6	934	0.143	0.139	A0A061I5T4.pdb.gz	A0A061I5T4_CRIGR E3 ubiquitin-protein ligase CBL (Fragment) OS=Cricetulus griseus OX=10029 GN=H671_4g13114 PE=1 SV=1
8	AFDB:Q9VCX1	0.086	0.058	2.082E-6	1541	0.144	0.085	Q9VCX1.pdb.gz	RGS_DROME Regulator of G-protein signaling loco OS=Drosophila melanogaster OX=7227 GN=loco PE=1 SV=2
9	AFDB:Q9UPX8	0.085	0.057	2.200E-6	1470	0.120	0.074	Q9UPX8.pdb.gz	SHAN2_HUMAN SH3 and multiple ankyrin repeat domains protein 2 OS=Homo sapiens OX=9606 GN=SHANK2 PE=1 SV=4
10	PDB:7p73A	0.085	0.182	2.585E-6	420	0.051	0.110	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
11	PDB:7pc3A	0.087	0.191	3.224E-6	405	0.047	0.106	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
12	PDB:6pcvA	0.085	0.102	5.920E-6	754	0.057	0.069	6pcvA.pdb.gz
13	PDB:6t36A	0.091	0.835	1.029E-5	93	0.025	0.247	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
14	PDB:7qqmA	0.091	0.190	1.214E-5	413	0.054	0.119	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	AFDB:Q9VUE8	0.107	0.041	1.796E-5	2637	0.120	0.041	Q9VUE8.pdb.gz	Q9VUE8_DROME Big bang, isoform C OS=Drosophila melanogaster OX=7227 GN=bbg PE=2 SV=2
16	AFDB:Q9R1L5	0.091	0.056	1.898E-5	1570	0.150	0.087	Q9R1L5.pdb.gz	MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Mast1 PE=1 SV=3
17	PDB:7pcbA	0.095	0.195	3.282E-5	415	0.055	0.120	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	AFDB:H3BJD6	0.089	0.065	3.892E-5	1292	0.123	0.087	H3BJD6.pdb.gz	H3BJD6_MOUSE Protein phosphatase 1, regulatory subunit 9A OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
19	AFDB:B1Q240	0.105	0.104	3.357E-4	915	0.084	0.083	B1Q240.pdb.gz	B1Q240_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=2
20	AFDB:O43166	0.089	0.047	8.125E-4	1804	0.114	0.057	O43166.pdb.gz	SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80VW5	0.0	1495	918	0.847	0.837	WHRN_MOUSE Whirlin OS=Mus musculus OX=10090 GN=Whrn PE=1 SV=3
2	Q810W9	0.0	1479	920	0.839	0.827	WHRN_RAT Whirlin OS=Rattus norvegicus OX=10116 GN=Whrn PE=1 SV=1
3	Q9P202	0.0	1824	907	1.000	1.000	WHRN_HUMAN Whirlin OS=Homo sapiens OX=9606 GN=WHRN PE=1 SV=4
4	M9PI53	8.63e-57	214	982	0.148	0.136	M9PI53_DROME Dyschronic, isoform J OS=Drosophila melanogaster OX=7227 GN=dysc PE=4 SV=1
5	B7Z049	1.37e-56	209	689	0.147	0.193	B7Z049_DROME Dyschronic, isoform F OS=Drosophila melanogaster OX=7227 GN=dysc PE=4 SV=1
6	B7Z048	2.02e-55	209	866	0.147	0.154	B7Z048_DROME Dyschronic, isoform E OS=Drosophila melanogaster OX=7227 GN=dysc PE=4 SV=1
7	M9PF56	3.03e-55	210	1254	0.148	0.107	M9PF56_DROME Dyschronic, isoform G OS=Drosophila melanogaster OX=7227 GN=dysc PE=4 SV=1
8	Q9VU98	3.66e-55	209	990	0.148	0.135	Q9VU98_DROME Dyschronic, isoform C OS=Drosophila melanogaster OX=7227 GN=dysc PE=4 SV=3
9	M9PFF3	6.38e-55	208	986	0.148	0.136	M9PFF3_DROME Dyschronic, isoform I OS=Drosophila melanogaster OX=7227 GN=dysc PE=4 SV=1
10	M9PFJ0	8.60e-55	208	1015	0.147	0.131	M9PFJ0_DROME Dyschronic, isoform H OS=Drosophila melanogaster OX=7227 GN=dysc PE=4 SV=1
11	D6BNA9	2.97e-44	175	954	0.114	0.108	D6BNA9_DANRE PDZ domain containing protein 7a OS=Danio rerio OX=7955 GN=si:dkey-158p2.1 PE=2 SV=1
12	A0A2R8YFN1	8.84e-44	170	573	0.112	0.178	A0A2R8YFN1_HUMAN PDZ domain containing 7 OS=Homo sapiens OX=9606 GN=PDZD7 PE=1 SV=1
13	A0A2R8Y892	2.15e-43	168	561	0.112	0.182	A0A2R8Y892_HUMAN PDZ domain containing 7 OS=Homo sapiens OX=9606 GN=PDZD7 PE=1 SV=1
14	Q9H5P4	2.54e-42	169	1033	0.112	0.099	PDZD7_HUMAN PDZ domain-containing protein 7 OS=Homo sapiens OX=9606 GN=PDZD7 PE=1 SV=2
15	E9Q9W7	4.17e-42	169	1021	0.107	0.095	PDZD7_MOUSE PDZ domain-containing protein 7 OS=Mus musculus OX=10090 GN=Pdzd7 PE=1 SV=2
16	Q29RC0	1.61e-35	144	548	0.114	0.188	Q29RC0_DANRE Harmonin OS=Danio rerio OX=7955 GN=zgc:136806 PE=1 SV=1
17	A0A0S2Z4U9	1.86e-33	138	552	0.117	0.192	A0A0S2Z4U9_HUMAN Usher syndrome 1C (Autosomal recessive, severe), isoform CRA_d (Fragment) OS=Homo sapiens OX=9606 GN=USH1C PE=2 SV=1
18	Q9Y6N9	1.86e-33	138	552	0.117	0.192	USH1C_HUMAN Harmonin OS=Homo sapiens OX=9606 GN=USH1C PE=1 SV=3
19	A0A8I5ZR66	1.42e-32	138	910	0.116	0.115	A0A8I5ZR66_RAT USH1 protein network component harmonin OS=Rattus norvegicus OX=10116 GN=Ush1c PE=4 SV=1
20	Q9ES64	3.13e-32	137	910	0.116	0.115	USH1C_MOUSE Harmonin OS=Mus musculus OX=10090 GN=Ush1c PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16545 CCM2_C	1.3	20.8	Cerebral cavernous malformation protein, harmonin-homology
2	PF08349 DUF1722	3.4e+02	12.9	Protein of unknown function (DUF1722)
3	PF19805 DUF6288	0.89	20.3	Family of unknown function (DUF6288)
4	PF00595 PDZ	2.3e-41	151.4	PDZ domain
5	PF13180 PDZ_2	1e-08	46.7	PDZ domain
6	PF17816 PDZ_4	67	15.2	PDZ domain
7	PF17820 PDZ_6	7.9e-24	94.6	PDZ domain
8	PF02163 Peptidase_M50	2.2e-09	48.7	Peptidase family M50

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354623

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000205890	0.998	Unconventional myosin-XV
2	9606.ENSP00000384582	0.996	G-protein coupled receptor 98
3	9606.ENSP00000305941	0.995	Usherin
4	9606.ENSP00000281172	0.972	Epidermal growth factor receptor kinase substrate 8
5	9606.ENSP00000386331	0.941	Unconventional myosin-VIIa
6	9606.ENSP00000278198	0.936	Leucine-rich repeat-containing protein 4C
7	9606.ENSP00000381768	0.915	Cadherin-23
8	9606.ENSP00000410083	0.908	Vezatin
9	9606.ENSP00000363068	0.906	Protocadherin-15
10	9606.ENSP00000480279	0.906	Usher syndrome type-1G protein
11	9606.ENSP00000329158	0.905	Clarin-1
12	9606.ENSP00000258930	0.893	Calcium and integrin-binding family member 2
13	9606.ENSP00000367059	0.874	Espin
14	9606.ENSP00000367766	0.872	X-linked retinitis pigmentosa GTPase regulator
15	9606.ENSP00000387100	0.871	Taperin
16	9606.ENSP00000480489	0.824	PDZ domain-containing protein 7
17	9606.ENSP00000288139	0.777	Voltage-dependent L-type calcium channel subunit alpha-1D
18	9606.ENSP00000345259	0.777	Protein 4.1
19	9606.ENSP00000311505	0.752	IQ calmodulin-binding motif-containing protein 1
20	9606.ENSP00000367408	0.749	Peripheral plasma membrane protein CASK

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.992	multicellular organismal process
GO:0050877	0.963	nervous system process
GO:0009987	0.957	cellular process
GO:0001895	0.926	retina homeostasis
GO:0007600	0.901	sensory perception
GO:0007605	0.880	sensory perception of sound
GO:0065007	0.803	biological regulation
GO:0050789	0.733	regulation of biological process
GO:0071840	0.559	cellular component organization or biogenesis
GO:0050794	0.526	regulation of cellular process
GO:0050953	0.515	sensory perception of light stimulus
GO:0016043	0.509	cellular component organization
GO:0032502	0.459	developmental process
GO:0048856	0.452	anatomical structure development
GO:0050896	0.397	response to stimulus
GO:0007275	0.330	multicellular organism development
GO:0048731	0.305	system development
GO:0048518	0.303	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043226	0.995	organelle
GO:0043227	0.990	membrane-bounded organelle
GO:0016020	0.989	membrane
GO:0043229	0.980	intracellular organelle
GO:0043232	0.970	intracellular non-membrane-bounded organelle
GO:0005829	0.916	cytosol
GO:0071944	0.908	cell periphery
GO:0042995	0.893	cell projection
GO:0120025	0.848	plasma membrane bounded cell projection
GO:0005886	0.837	plasma membrane
GO:0005856	0.816	cytoskeleton
GO:0005929	0.800	cilium
GO:0032991	0.774	protein-containing complex
GO:0043005	0.620	neuron projection
GO:0030054	0.580	cell junction
GO:0098858	0.546	actin-based cell projection
GO:0097731	0.506	9+0 non-motile cilium
GO:0097733	0.498	photoreceptor cell cilium
GO:0015630	0.438	microtubule cytoskeleton
GO:0043231	0.419	intracellular membrane-bounded organelle
GO:0032420	0.373	stereocilium
GO:0001917	0.331	photoreceptor inner segment
GO:0035869	0.329	ciliary transition zone

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]