StarFunc result for job id Q9P206

User Input

>input (1035 residues)
MVVFVGRRLPALLGLFKKKGSAKAENDKHLSVGPGQGPGSAVDEHQDNVFFPSGRPPHLE
ELHTQAQEGLRSLQHQEKQKLNKGGWDHGDTQSIQSSRTGPDEDNISFCSQTTSYVAESS
TAEDALSIRSEMIQRKGSTFRPHDSFPKSGKSGRRRRERRSTVLGLPQHVQKELGLRNER
EAPGTPRAPGARDAVRIPTVDGRPRGTSGMGARVSLQALEAEAEAGAETEAMLQRHIDRV
YRDDTFVGRSTGTRAPPLTRPMSLAVPGLTGGAGPAEPLSPAMSISPQATYLSKLIPHAV
LPPTVDVVALGRCSLRTLSRCSLHSASPASVRSLGRFSSVSSPQPRSRHPSSSSDTWSHS
QSSDTIVSDGSTLSSKGGSEGQPESSTASNSVVPPPQGGSGRGSPSGGSTAEASDTLSIR
SSGQLSGRSVSLRKLKRPPPPPRRTHSLHQRGLAVPDGPLGLPPKPERKQQPQLPRPPTT
GGSEGAGAAPCPPNPANSWVPGLSPGGSRRPPRSPERTLSPSSGYSSQSGTPTLPPKGLA
GPPASPGKAQPPKPERVTSLRSPGASVSSSLTSLCSSSSDPAPSDRSGPQILTPLGDRFV
IPPHPKVPAPFSPPPSKPRSPNPAAPALAAPAVVPGPVSTTDASPQSPPTPQTTLTPLQE
SPVISKDQSPPPSPPPSYHPPPPPTKKPEVVVEAPSASETAEEPLQDPNWPPPPPPAPEE
QDLSMADFPPPEEAFFSVASPEPAGPSGSPELVSSPAASSSSATALQIQPPGSPDPPPAP
PAPAPASSAPGHVAKLPQKEPVGCSKGGGPPREDVGAPLVTPSLLQMVRLRSVGAPGGAP
TPALGPSAPQKPLRRALSGRASPVPAPSSGLHAAVRLKACSLAASEGLSSAQPNGPPEAE
PRPPQSPASTASFIFSKGSRKLQLERPVSPETQADLQRNLVAELRSISEQRPPQAPKKSP
KAPPPVARKPSVGVPPPASPSYPRAEPLTAPPTNGLPHTQDRTKRELAENGGVLQLVGPE
EKMGLPGSDSQKELA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZ56	0.043	0.031	1.061E-5	1722	0.219	0.132	Q9NZ56.pdb.gz	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
2	AFDB:Q9UPN6	0.054	0.046	1.618E-3	1271	0.160	0.131	Q9UPN6.pdb.gz	SCAF8_HUMAN SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1
3	AFDB:Q6DRQ0	0.050	0.055	5.239E-3	925	0.130	0.146	Q6DRQ0.pdb.gz
4	AFDB:A7MD62	0.036	0.038	8.275E-3	845	0.124	0.151	A7MD62.pdb.gz
5	AFDB:P20676	0.047	0.045	1.007E-2	1076	0.145	0.139	P20676.pdb.gz	NUP1_YEAST Nucleoporin NUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP1 PE=1 SV=1
6	AFDB:Q9JL04	0.045	0.032	1.074E-2	1578	0.209	0.137	Q9JL04.pdb.gz	FMN2_MOUSE Formin-2 OS=Mus musculus OX=10090 GN=Fmn2 PE=1 SV=2
7	AFDB:B4DTV0	0.035	0.034	2.861E-2	1079	0.150	0.144	B4DTV0.pdb.gz	B4DTV0_HUMAN cDNA FLJ57801, highly similar to Homo sapiens AHNAK nucleoprotein (desmoyokin) (AHNAK), transcript variant 1, mRNA (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
8	AFDB:F1Q9U2	0.035	0.023	2.861E-2	2065	0.155	0.077	F1Q9U2.pdb.gz
9	AFDB:Q6UB98	0.039	0.022	3.480E-2	2062	0.129	0.065	Q6UB98.pdb.gz	ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ANKRD12 PE=1 SV=3
10	AFDB:G3V672	0.041	0.039	4.823E-2	1162	0.153	0.136	G3V672.pdb.gz	G3V672_RAT Nuclear receptor interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Nrip1 PE=4 SV=1
11	PDB:7d4iRJ	0.026	0.036	4.069	738	0.011	0.015	7d4iRJ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
12	PDB:7ajtCL	0.026	0.034	4.343	781	0.010	0.013	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	PDB:7d63RJ	0.026	0.034	4.343	796	0.010	0.013	7d63RJ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
14	PDB:6mzcK	0.037	0.135	6.426	202	0.020	0.104	6mzcK.pdb.gz
15	PDB:7ajuCL	0.026	0.033	6.426	808	0.012	0.015	7ajuCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:7mq8LN	0.014	0.022	6.426	671	0.004	0.006	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:6y4lB	0.020	0.096	7.816	185	0.006	0.032	6y4lB.pdb.gz
18	PDB:7mq9SI	0.031	0.036	8.343	844	0.019	0.024	7mq9SI.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:6bk8E	0.027	0.145	8.906	186	0.014	0.075	6bk8E.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
20	PDB:7w59R	0.029	0.081	8.906	280	0.019	0.071	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EXR7	0.099	39.3	1606	0.025	0.016	E7EXR7_DANRE NHS-like 1b OS=Danio rerio OX=7955 GN=nhsl1b PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15273 NHS	0.0012	29.7	NHS-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000000857

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000016595	0.751	BAI1-associated protein 2
2	9598.ENSPTRP00000031250	0.538	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0048731	0.943	system development
GO:0065007	0.881	biological regulation
GO:0050794	0.865	regulation of cellular process
GO:0071840	0.771	cellular component organization or biogenesis
GO:0030154	0.527	cell differentiation
GO:0007399	0.450	nervous system development
GO:0050896	0.437	response to stimulus
GO:0022008	0.400	neurogenesis
GO:0048699	0.390	generation of neurons
GO:0001764	0.362	neuron migration
GO:0016043	0.319	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005622	0.992	intracellular anatomical structure
GO:0005737	0.937	cytoplasm
GO:0043226	0.911	organelle
GO:0043227	0.828	membrane-bounded organelle
GO:0071944	0.821	cell periphery
GO:0043229	0.798	intracellular organelle
GO:0043231	0.766	intracellular membrane-bounded organelle
GO:0005886	0.763	plasma membrane
GO:0043233	0.317	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]