StarFunc result for job id Q9P212

User Input

>input (2302 residues)
MTSEEMTASVLIPVTQRKVVSAQSAADESSEKVSDINISKAHTVRRSGETSHTISQLNKL
KEEPSGSNLPKILSIAREKIVSDENSNEKCWEKIMPDSAKNLNINCNNILRNHQHGLPQR
QFYEMYNSVAEEDLCLETGIPSPLERKVFPGIQLELDRPSMGISPLGNQSVIIETGRAHP
DSRRAVFHFHYEVDRRMSDTFCTLSENLILDDCGNCVPLPGGEEKQKKNYVAYTCKLMEL
AKNCDNKNEQLQCDHCDTLNDKYFCFEGSCEKVDMVYSGDSFCRKDFTDSQAAKTFLSHF
EDFPDNCDDVEEDAFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIVRTLPSGHIGLTA
WSYIDQKRNGPLLPCGRVMEPPSTVEIRQDGSQRLSEAQWYPIYNAVRREETENTVGSLL
HFLTKLPASETAHGRISVGPCLKQCVRDTVCEYRATLQRTSISQYITGSLLEATTSLGAR
SGLLSTFGGSTGRMMLKERQPGPSVANSNALPSSSAGISKELIDLQPLIQFPEEVASILM
EQEQTIYRRVLPVDYLCFLTRDLGTPECQSSLPCLKASISASILTTQNGEHNALEDLVMR
FNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMW
QFMDQSDIETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDGA
SGLMKLCPRYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCNRS
LETDEEDSPSEGNSSRKSSLKDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDSQKAFD
HGTELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWVKPTTAS
PASSKAKLGVLNNTAEPGKFPLLGNAGLSSLTEGVLDLFAVKAVYMGHPGIDIHTVCVQN
KLGSMFLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQRQ
QWLRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSARNPSPGTSAKNAEKPNMQRNNTLG
ISTTKKKKKILMRGESGEVTDDEMATRKAKMHKECRSRSGSDPQDINEQEESEVNAIANP
PNPLPSRRAHSLTTAGSPNLAAGTSSPIRPVSSPVLSSSNKSPSSAWSSSSWHGRIKGGM
KGFQSFMVSDSNMSFVEFVELFKSFSVRSRKDLKDLFDVYAVPCNRSGSESAPLYTNLTI
DENTSDLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLG
IFGVGILQLNDFLVNCQGEHCTYDEILSIIQKFEPSISMCHQGLMSFEGFARFLMDKENF
ASKNDESQENIKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDC
WDGDDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFINSDLPIIISIENHCSLPQQRKMAEI
FKTVFGEKLVTKFLFETDFSDDPMLPSPDQLRKKVLLKNKKLKAHQTPVDILKQKAHQLA
SMQVQAYNGGNANPRPANNEEEEDEEDEYDYDYESLSDDNILEDRPENKSCNDKLQFEYN
EEIPKRIKKADNSACNKGKVYDMELGEEFYLDQNKKESRQIAPELSDLVIYCQAVKFPGL
STLNASGSSRGKERKSRKSIFGNNPGRMSPGETASFNKTSGKSSCEGIRQTWEESSSPLN
PTTSLSAIIRTPKCYHISSLNENAAKRLCRRYSQKLTQHTACQLLRTYPAATRIDSSNPN
PLMFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLE
RDLDSMDPAVYSLTIVSGQNVCPSNSMGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMW
NEQFLFHVHFEDLVFLRFAVVENNSSAVTAQRIIPLKALKRGYRHLQLRNLHNEVLEISS
LFINSRRMEENSSGNTMSASSMFNTEERKCLQTHRVTVHGVPGPEPFTVFTINGGTKAKQ
LLQQILTNEQDIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAIGPEEEIMQILSSWFPE
EGYMGRIVLKTQQENLEEKNIVQDDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVST
AQDVIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDTTNKKTTTPKSSQRVLLDQECVFQ
AQSKWKGAGKFILKLKEQVQASREDKKKGISFASELKKLTKSTKQPRGLTSPSQLLTSES
IQTKEEKPVGGLSSSDTMDYRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8K4S1	0.751	0.758	0.000	2282	0.848	0.856	Q8K4S1.pdb.gz	PLCE1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Mus musculus OX=10090 GN=Plce1 PE=1 SV=3
2	AFDB:Q9P212	1.000	1.000	0.000	2302	1.000	1.000	Q9P212.pdb.gz	PLCE1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Homo sapiens OX=9606 GN=PLCE1 PE=1 SV=3
3	PDB:4gnkB	0.266	0.737	1.042E-39	769	0.102	0.304	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
4	AFDB:Q4KWH8	0.267	0.357	1.265E-34	1693	0.123	0.168	Q4KWH8.pdb.gz	PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
5	AFDB:Q4KWH5	0.252	0.338	1.297E-33	1682	0.123	0.168	Q4KWH5.pdb.gz	PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus OX=10090 GN=Plch1 PE=2 SV=1
6	AFDB:P97433	0.057	0.072	1.409E-5	1693	0.059	0.080	P97433.pdb.gz	ARG28_MOUSE Rho guanine nucleotide exchange factor 28 OS=Mus musculus OX=10090 GN=Arhgef28 PE=1 SV=2
7	AFDB:Q8IQ97	0.055	0.085	2.142E-5	1311	0.065	0.114	Q8IQ97.pdb.gz	Q8IQ97_DROME Pebble, isoform B OS=Drosophila melanogaster OX=7227 GN=pbl PE=4 SV=1
8	PDB:1cjyA	0.048	0.168	2.190E-5	633	0.007	0.027	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
9	PDB:5ixcA	0.048	0.154	3.827E-5	684	0.015	0.050	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
10	AFDB:G5E870	0.041	0.044	4.511E-5	2025	0.061	0.070	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
11	AFDB:Q54YZ6	0.056	0.095	4.726E-5	1218	0.052	0.098	Q54YZ6.pdb.gz	Q54YZ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=gxcA PE=4 SV=1
12	AFDB:Q14669	0.048	0.053	7.886E-5	1992	0.070	0.081	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
13	PDB:5izrC	0.046	0.155	1.017E-4	659	0.008	0.027	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	AFDB:E7EY47	0.052	0.098	1.379E-4	958	0.052	0.125	E7EY47.pdb.gz	E7EY47_DANRE Rho guanine nucleotide exchange factor (GEF) 19 OS=Danio rerio OX=7955 GN=arhgef19 PE=4 SV=1
15	PDB:2byvE	0.065	0.156	1.778E-4	922	0.016	0.039	2byvE.pdb.gz
16	PDB:5iz5B	0.048	0.141	3.744E-4	746	0.015	0.046	5iz5B.pdb.gz
17	PDB:6yvaC	0.029	0.364	6.857E-4	155	0.008	0.116	6yvaC.pdb.gz
18	PDB:5a50A	0.048	0.561	7.184E-4	165	0.010	0.139	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:4rj9A	0.047	0.572	9.951E-4	161	0.009	0.130	4rj9A.pdb.gz
20	PDB:5a52A	0.045	0.558	9.951E-4	154	0.008	0.117	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C5H807	0.0	2499	2248	0.560	0.574	C5H807_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plce1 PE=2 SV=1
2	G5EFI8	0.0	687	1898	0.225	0.273	PLCE1_CAEEL 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Caenorhabditis elegans OX=6239 GN=plc-1 PE=1 SV=1
3	Q8K4S1	0.0	3929	2282	0.848	0.855	PLCE1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Mus musculus OX=10090 GN=Plce1 PE=1 SV=3
4	Q99P84	0.0	3935	2281	0.843	0.851	PLCE1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Rattus norvegicus OX=10116 GN=Plce1 PE=1 SV=1
5	Q9P212	0.0	4804	2302	1.000	1.000	PLCE1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Homo sapiens OX=9606 GN=PLCE1 PE=1 SV=3
6	A2AT91	6.85e-93	325	883	0.099	0.257	A2AT91_MOUSE Phosphoinositide phospholipase C (Fragment) OS=Mus musculus OX=10090 GN=Plcb4 PE=1 SV=1
7	Q5FWA6	2.32e-91	321	892	0.098	0.252	Q5FWA6_MOUSE Phosphoinositide phospholipase C (Fragment) OS=Mus musculus OX=10090 GN=Plcb4 PE=2 SV=1
8	V9GXQ9	2.58e-90	321	1022	0.097	0.219	V9GXQ9_MOUSE Phosphoinositide phospholipase C OS=Mus musculus OX=10090 GN=Plcb4 PE=1 SV=1
9	Q91UZ1	2.49e-89	321	1175	0.097	0.191	Q91UZ1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Mus musculus OX=10090 GN=Plcb4 PE=1 SV=1
10	Q9QW07	2.93e-89	321	1175	0.096	0.188	PLCB4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Rattus norvegicus OX=10116 GN=Plcb4 PE=1 SV=2
11	Q15147	7.32e-89	320	1175	0.097	0.191	PLCB4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Homo sapiens OX=9606 GN=PLCB4 PE=1 SV=3
12	Q4KWH5	2.16e-82	304	1682	0.096	0.131	PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus OX=10090 GN=Plch1 PE=2 SV=1
13	A2AP18	1.31e-79	294	1501	0.092	0.141	PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus OX=10090 GN=Plch2 PE=1 SV=2
14	Q804J6	9.73e-50	197	1312	0.042	0.074	Q804J6_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma OS=Danio rerio OX=7955 GN=fj46f04 PE=1 SV=1
15	P08487	9.08e-49	194	1291	0.044	0.079	PLCG1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Bos taurus OX=9913 GN=PLCG1 PE=1 SV=1
16	F1SDV6	9.39e-49	194	1291	0.044	0.079	F1SDV6_PIG 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma OS=Sus scrofa OX=9823 GN=PLCG1 PE=1 SV=5
17	P19174	1.45e-48	193	1290	0.044	0.079	PLCG1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1 PE=1 SV=1
18	A0A2U3TZV8	2.92e-48	193	1685	0.044	0.060	A0A2U3TZV8_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
19	Q4KWH8	2.99e-48	193	1693	0.044	0.060	PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
20	Q62077	8.49e-48	191	1302	0.044	0.078	PLCG1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Mus musculus OX=10090 GN=Plcg1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	0.0001	33.9	C2 domain
2	PF09279 EF-hand_like	0.097	24.5	Phosphoinositide-specific phospholipase C, efhand-like
3	PF00388 PI-PLC-X	2.4e-55	197.6	Phosphatidylinositol-specific phospholipase C, X domain
4	PF00387 PI-PLC-Y	2.4e-31	119.8	Phosphatidylinositol-specific phospholipase C, Y domain
5	PF00788 RA	1.1e-17	75.8	Ras association (RalGDS/AF-6) domain
6	PF00617 RasGEF	3.2e-17	74.9	RasGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360431

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000407586	0.992	GTPase HRas
2	9606.ENSP00000319096	0.943	Ras-related protein Rap-2b
3	9606.ENSP00000256078	0.941	GTPase KRas
4	9606.ENSP00000246792	0.938	Ras-related protein R-Ras
5	9606.ENSP00000265382	0.931	Phosphatidylinositol 4-phosphate 5-kinase type-1 beta
6	9606.ENSP00000466363	0.931	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
7	9606.ENSP00000357883	0.930	Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
8	9606.ENSP00000373399	0.930	Phosphatidylinositol 4-phosphate 5-kinase-like protein 1
9	9606.ENSP00000347032	0.921	Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma
10	9606.ENSP00000365757	0.919	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
11	9606.ENSP00000482548	0.919	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta
12	9606.ENSP00000357583	0.901	Type I inositol 1,4,5-trisphosphate 5-phosphatase
13	9606.ENSP00000400175	0.897	Transforming protein RhoA
14	9606.ENSP00000358723	0.892	Ras-related protein Rap-1A
15	9606.ENSP00000358548	0.882	GTPase NRas
16	9606.ENSP00000306253	0.877	Inositol 1,4,5-trisphosphate receptor type 1
17	9606.ENSP00000363435	0.877	Inositol 1,4,5-trisphosphate receptor type 3
18	9606.ENSP00000256196	0.861	Ras-related protein R-Ras2
19	9606.ENSP00000408695	0.857	Protein kinase C alpha type
20	9606.ENSP00000370744	0.852	Inositol 1,4,5-trisphosphate receptor type 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004435	0.998	phosphatidylinositol phospholipase C activity
GO:0019899	0.989	enzyme binding
GO:0051020	0.976	GTPase binding
GO:0031267	0.968	small GTPase binding
GO:0030695	0.967	GTPase regulator activity
GO:0140677	0.960	molecular function activator activity
GO:0140678	0.959	molecular function inhibitor activity
GO:0005085	0.947	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0023052	0.993	signaling
GO:0007154	0.993	cell communication
GO:0051716	0.993	cellular response to stimulus
GO:0007165	0.940	signal transduction
GO:0035556	0.921	intracellular signal transduction
GO:0032501	0.787	multicellular organismal process
GO:0071704	0.738	organic substance metabolic process
GO:0044237	0.714	cellular metabolic process
GO:0044238	0.706	primary metabolic process
GO:0007264	0.697	small GTPase mediated signal transduction
GO:0006629	0.688	lipid metabolic process
GO:0007265	0.654	Ras protein signal transduction
GO:0048518	0.642	positive regulation of biological process
GO:0048583	0.618	regulation of response to stimulus
GO:0048522	0.614	positive regulation of cellular process
GO:0046486	0.560	glycerolipid metabolic process
GO:0007186	0.497	G protein-coupled receptor signaling pathway
GO:0019222	0.477	regulation of metabolic process
GO:0009966	0.470	regulation of signal transduction
GO:0032502	0.467	developmental process
GO:1901576	0.446	organic substance biosynthetic process
GO:0044249	0.446	cellular biosynthetic process
GO:0048856	0.429	anatomical structure development
GO:0045017	0.427	glycerolipid biosynthetic process
GO:0031323	0.413	regulation of cellular metabolic process
GO:0007275	0.367	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.991	plasma membrane
GO:0005829	0.991	cytosol
GO:0043226	0.779	organelle
GO:0043229	0.712	intracellular organelle
GO:0031252	0.709	cell leading edge
GO:0042995	0.697	cell projection
GO:0120025	0.691	plasma membrane bounded cell projection
GO:0043227	0.595	membrane-bounded organelle
GO:0043231	0.430	intracellular membrane-bounded organelle
GO:0030027	0.399	lamellipodium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:33179	0.998	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+)
EC:3.1.4.11	0.998	phosphoinositide phospholipase C.

[back to server]