StarFunc result for job id Q9P215

User Input

>input (609 residues)
MESTAYPLNLSLKEEEEEEEIQSRELEDGPADMQKVRICSEGGWVPALFDEVAIYFSDEE
WEVLTEQQKALYREVMRMNYETVLSLEFPFPKPDMITRLEGEEESQNSDEWQLQGGTSAE
NEESDVKPPDWPNPMNATSQFPQPQHFDSFGLRLPRDITELPEWSEGYPFYMAMGFPGYD
LSADDIAGKFQFSRGMRRSYDAGFKLMVVEYAESTNNCQAAKQFGVLEKNVRDWRKVKPQ
LQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPE
KGFKASLGWCRRMMRRYDLSLRHKVPVPQHLPEDLTEKLVTYQRSVLALRRAHDYEVAQM
GNADETPICLEVPSRVTVDNQGEKPVLVKTPGREKLKITAMLGVLADGRKLPPYIILRGT
YIPPGKFPSGMEIRCHRYGWMTEDLMQDWLEVVWRRRTGAVPKQRGMLILNGFRGHATDS
VKNSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAK
KPPLGLFLEWVMVAWNSISSESIVQGFKKCHISSNLEEEDDVLWEIESELPGGGEPPKDC
DTESMAESN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R8Y1	0.620	0.620	2.747E-98	609	1.000	1.000	A0A024R8Y1.pdb.gz
2	AFDB:Q7Z3K3	0.316	0.145	4.607E-23	1410	0.190	0.082	Q7Z3K3.pdb.gz	POGZ_HUMAN Pogo transposable element with ZNF domain OS=Homo sapiens OX=9606 GN=POGZ PE=1 SV=2
3	AFDB:A8E7N7	0.308	0.157	1.076E-17	1277	0.140	0.067	A8E7N7.pdb.gz	A8E7N7_DANRE Pogo transposable element-derived with ZNF domain a OS=Danio rerio OX=7955 GN=im:7136628 PE=1 SV=1
4	AFDB:Q53EQ6	0.266	0.254	7.114E-16	642	0.151	0.143	Q53EQ6.pdb.gz	TIGD5_HUMAN Tigger transposable element-derived protein 5 OS=Homo sapiens OX=9606 GN=TIGD5 PE=1 SV=3
5	AFDB:Q9UJL9	0.091	0.103	2.051E-4	534	0.066	0.075	Q9UJL9.pdb.gz	ZF69B_HUMAN Zinc finger protein 69 homolog B OS=Homo sapiens OX=9606 GN=ZFP69B PE=1 SV=2
6	AFDB:Q9BSG1	0.106	0.148	2.410E-4	425	0.102	0.146	Q9BSG1.pdb.gz	ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens OX=9606 GN=ZNF2 PE=1 SV=5
7	AFDB:P0C7X2	0.117	0.241	2.988E-4	276	0.085	0.188	P0C7X2.pdb.gz	ZN688_HUMAN Zinc finger protein 688 OS=Homo sapiens OX=9606 GN=ZNF688 PE=1 SV=1
8	AFDB:Q3KNS6	0.095	0.126	3.511E-4	432	0.094	0.132	Q3KNS6.pdb.gz	ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens OX=9606 GN=ZNF829 PE=1 SV=1
9	AFDB:Q96H86	0.104	0.149	3.511E-4	408	0.105	0.157	Q96H86.pdb.gz	ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens OX=9606 GN=ZNF764 PE=1 SV=2
10	AFDB:Q5HYK9	0.098	0.098	3.705E-4	610	0.117	0.116	Q5HYK9.pdb.gz	ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens OX=9606 GN=ZNF667 PE=1 SV=2
11	PDB:7pikC	0.125	0.134	4.731E-4	557	0.087	0.095	7pikC.pdb.gz	Structural basis of transposon end recognition explains central features of Tn7 transposition systems.
12	PDB:1s5jA	0.154	0.136	4.094E-2	727	0.054	0.045	1s5jA.pdb.gz	Insights into DNA replication: the crystal structure of DNA polymerase B1 from the archaeon Sulfolobus solfataricus
13	PDB:7pubCK	0.123	0.225	7.803E-2	298	0.076	0.154	7pubCK.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
14	PDB:2oyqA	0.136	0.108	1.021E-1	848	0.062	0.045	2oyqA.pdb.gz	Caught bending the a-rule: crystal structures of translesion DNA synthesis with a non-natural nucleotide.
15	PDB:4s2rP	0.120	0.119	1.077E-1	615	0.046	0.046	4s2rP.pdb.gz	Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: A cytosolic enzyme with a di-nuclear active site.
16	PDB:6styA	0.132	0.315	1.656E-1	198	0.054	0.167	6styA.pdb.gz	Human REXO2 controls short mitochondrial RNAs generated by mtRNA processing and decay machinery to prevent accumulation of double-stranded RNA.
17	PDB:4hecB	0.081	0.224	3.156E-1	163	0.030	0.110	4hecB.pdb.gz	Mycobacterium tuberculosis Rv2179c Protein Establishes a New Exoribonuclease Family with Broad Phylogenetic Distribution.
18	PDB:8dqwE	0.101	0.159	3.156E-1	354	0.054	0.093	8dqwE.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
19	PDB:7tfhB	0.077	0.137	3.330E-1	320	0.048	0.091	7tfhB.pdb.gz	Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
20	PDB:3k5nA	0.121	0.103	3.514E-1	759	0.034	0.028	3k5nA.pdb.gz	Structural insight into translesion synthesis by DNA Pol II.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P215	0.0	1265	609	1.000	1.000	POGK_HUMAN Pogo transposable element with KRAB domain OS=Homo sapiens OX=9606 GN=POGK PE=1 SV=2
2	Q5TIJ2	5.26e-150	432	209	0.343	1.000	Q5TIJ2_HUMAN Pogo transposable element derived with KRAB domain (Fragment) OS=Homo sapiens OX=9606 GN=POGK PE=1 SV=1
3	Q7Z3K3	3.41e-20	97.8	1410	0.128	0.055	POGZ_HUMAN Pogo transposable element with ZNF domain OS=Homo sapiens OX=9606 GN=POGZ PE=1 SV=2
4	Q6ZMS7	2.37e-13	75.1	546	0.074	0.082	ZN783_HUMAN Zinc finger protein 783 OS=Homo sapiens OX=9606 GN=ZNF783 PE=1 SV=2
5	Q3V362	6.20e-12	70.9	622	0.076	0.074	Q3V362_MOUSE Zinc finger protein 251 (Fragment) OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
6	Q3USU9	6.44e-12	70.9	632	0.076	0.073	Q3USU9_MOUSE Zinc finger protein 251 OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
7	Q6PCX8	6.55e-12	70.9	632	0.076	0.073	Q6PCX8_MOUSE Zinc finger protein 251 OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
8	Q17RP2	1.17e-11	69.7	521	0.141	0.165	TIGD6_HUMAN Tigger transposable element-derived protein 6 OS=Homo sapiens OX=9606 GN=TIGD6 PE=2 SV=2
9	A0A2R8YDQ5	1.40e-11	69.7	659	0.049	0.046	A0A2R8YDQ5_HUMAN Zinc finger protein 746 OS=Homo sapiens OX=9606 GN=ZNF746 PE=1 SV=1
10	Q96C28	2.43e-11	68.2	371	0.051	0.084	ZN707_HUMAN Zinc finger protein 707 OS=Homo sapiens OX=9606 GN=ZNF707 PE=1 SV=2
11	Q9ULD5	3.15e-11	68.9	831	0.056	0.041	ZN777_HUMAN Zinc finger protein 777 OS=Homo sapiens OX=9606 GN=ZNF777 PE=1 SV=3
12	A0A090N7U3	3.32e-11	68.6	752	0.049	0.040	A0A090N7U3_HUMAN Zinc finger protein 425 OS=Homo sapiens OX=9606 GN=LOC155054 PE=4 SV=1
13	Q6IV72	3.32e-11	68.6	752	0.049	0.040	ZN425_HUMAN Zinc finger protein 425 OS=Homo sapiens OX=9606 GN=ZNF425 PE=1 SV=1
14	Q6ZNG0	3.42e-11	67.8	422	0.061	0.088	ZN620_HUMAN Zinc finger protein 620 OS=Homo sapiens OX=9606 GN=ZNF620 PE=1 SV=1
15	Q8TD17	3.93e-11	68.2	642	0.046	0.044	ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens OX=9606 GN=ZNF398 PE=1 SV=1
16	Q8N393	1.52e-10	66.6	782	0.048	0.037	ZN786_HUMAN Zinc finger protein 786 OS=Homo sapiens OX=9606 GN=ZNF786 PE=1 SV=2
17	Q9BRH9	1.94e-10	66.2	671	0.051	0.046	ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens OX=9606 GN=ZNF251 PE=1 SV=4
18	Q923B3	4.79e-10	65.1	828	0.057	0.042	NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus OX=10090 GN=Nrif1 PE=1 SV=3
19	Q9QXT9	5.08e-10	64.7	601	0.048	0.048	Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus OX=10090 GN=Znf354b PE=2 SV=1
20	A8K8V0	5.25e-10	63.9	405	0.053	0.079	ZN785_HUMAN Zinc finger protein 785 OS=Homo sapiens OX=9606 GN=ZNF785 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09607 BrkDBD	8.6e-27	104.2	Brinker DNA-binding domain
2	PF04218 CENP-B_N	6.1e+02	11.5	CENP-B N-terminal DNA-binding domain
3	PF03184 DDE_1	5.7e-40	148.3	DDE superfamily endonuclease
4	PF03221 HTH_Tnp_Tc5	3.9e-10	50.9	Tc5 transposase DNA-binding domain
5	PF01352 KRAB	8.6e-12	55.8	KRAB box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356849

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000445905	0.789	EVI5-like protein
2	9606.ENSP00000289359	0.775	MIT domain-containing protein 1
3	9606.ENSP00000294818	0.706	Leucine-rich repeat-containing protein 52
4	9606.ENSP00000386184	0.706	Protein ZBED8
5	9606.ENSP00000480514	0.701	Calcium load-activated calcium channel
6	9606.ENSP00000356864	0.694	Microsomal glutathione S-transferase 3
7	9606.ENSP00000345667	0.692	Immunoglobulin-like domain-containing receptor 1
8	9606.ENSP00000381970	0.682	Gypsy retrotransposon integrase 1
9	9606.ENSP00000264255	0.677	Thioredoxin domain-containing protein 9
10	9606.ENSP00000324827	0.673	A-kinase anchor protein 17A
11	9606.ENSP00000356853	0.648	Uridine-cytidine kinase 2
12	9606.ENSP00000331643	0.633	piggyBac transposable element derived 2
13	9606.ENSP00000253024	0.627	Transcription intermediary factor 1-beta
14	9606.ENSP00000362170	0.626	Nuclear apoptosis-inducing factor 1
15	9606.ENSP00000259883	0.617	PiggyBac transposable element-derived protein 1
16	9606.ENSP00000217971	0.593	Membrane-associated progesterone receptor component 1
17	9606.ENSP00000289371	0.571	Eukaryotic translation initiation factor 5B
18	9606.ENSP00000345968	0.571	N-acetylmuramoyl-L-alanine amidase
19	9606.ENSP00000371994	0.564	Protein NYNRIN
20	9606.ENSP00000305533	0.556	DNA transposase THAP9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.979	biological regulation
GO:0050789	0.949	regulation of biological process
GO:0009987	0.839	cellular process
GO:0050794	0.773	regulation of cellular process
GO:0010468	0.566	regulation of gene expression
GO:0051252	0.554	regulation of RNA metabolic process
GO:0009889	0.541	regulation of biosynthetic process
GO:0010556	0.533	regulation of macromolecule biosynthetic process
GO:0031326	0.533	regulation of cellular biosynthetic process
GO:0032502	0.523	developmental process
GO:2001141	0.523	regulation of RNA biosynthetic process
GO:1903506	0.506	regulation of nucleic acid-templated transcription
GO:0006355	0.481	regulation of DNA-templated transcription
GO:0008152	0.301	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.558	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]