StarFunc result for job id Q9P217

User Input

>input (1185 residues)
MADGGEREELLSPSPVSPAKRQCSWPSPQAHHPRGSPGAAGGGAGGVGSSCLVLGARPHL
QPDSLLDCAAKTVAEKWAYERVEERFERIPEPVQRRIVYWSFPRNEREICMYSSFQYRGG
PGAGAAGGAAGASPAEEGPQPPPGAAAPAGSAPGGVAAGASPGLGAGAGAAGCGGEGLPF
RRGIRLLDSGSVENVLQVGFHLSGTVTELATASEPAVTYKVAISFDRCKITSVTCGCGNK
DIFYCAHVVALSLYRIRKPDQVKLRLPISETLFQMNRDQLQKFIQYLITAHHTEVLPTAQ
KLADEILSSNSEINQVNGAPDPTAGASIDDENCWHLDEEQVKEQVKLFLSQGGYCGSGKQ
LNSMFAKVREMLRMRDSNGARMLTLITEQFVADPRLTLWRQQGTNMTDKCRQLWDELGAL
WVCIILNPHCKLEEKSCWLQQLQKWSDLDVCPLEDGNYGHELPNITNALPQSAIHSPDSL
SRPRRTVFTRAIEGRELHWQDSHLQRIISSDVYTAPACQRESERLLFNSQGQPLWLEHVP
TACARVDALRSHGYPKEALRLTVAIINTLRLQQQRQLEIYKHQKKELLQRGTTTITNLEG
WVGHPLDPIDCLFLTLTEACRLNDDGYLEMSDMNESRPPVYQHVPVAAGSPNSSESYLSL
ALEVALMGLGQQRLMPEGLYAQDKVCRNEEQLLSQLQELQLDDELVQTLQKQCILLLEGG
PFSGLGEVIHRESVPMHTFAKYLFSALLPHDPDLSYKLALRAMRLPVLENSASAGDTSHP
HHMVSVVPSRYPRWFTLGHLESQQCELASTMLTAAKGDTLRLRTILEAIQKHIHSSSLIF
KLAQDAFKIATPTDSSTDSTLLNVALELGLQVMRMTLSTLNWRRREMVRWLVTCATEVGV
RALVSILQSWYTLFTPTEATSIVAATAVSHTTILRLSLDYPQREELASCARTLALQCAMK
DPQSCALSALTLCEKDHIAFEAAYQIAIDAAAGGMTHSQLFTIARYMELRGYPLRAFKLA
SLAMSHLNLAYNQDTHPAINDVLWACALSHSLGKNELAALIPLVVKSVHCATVLSDILRR
CTVTAPGLAGIPGRRSSGKLMSTDKAPLRQLLDATINAYINTTHSRLTHISPRHYGEFIE
FLSKARETFLLPQDGHLQFAQFIDNLKQIYKGKKKLMLLVRERFG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80TB7	0.886	0.870	0.000	1207	0.722	0.709	Q80TB7.pdb.gz	ZSWM6_MOUSE Zinc finger SWIM domain-containing protein 6 OS=Mus musculus OX=10090 GN=Zswim6 PE=1 SV=3
2	AFDB:Q8C7B8	0.871	0.936	0.000	1101	0.619	0.667	Q8C7B8.pdb.gz	ZSWM4_MOUSE Zinc finger SWIM domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zswim4 PE=1 SV=2
3	AFDB:Q9P217	1.000	1.000	0.000	1185	1.000	1.000	Q9P217.pdb.gz	ZSWM5_HUMAN Zinc finger SWIM domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZSWIM5 PE=2 SV=2
4	AFDB:A7E2V4	0.424	0.296	5.192E-29	1837	0.267	0.172	A7E2V4.pdb.gz	ZSWM8_HUMAN Zinc finger SWIM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZSWIM8 PE=1 SV=1
5	AFDB:Q9VWN9	0.502	0.313	4.943E-27	2103	0.259	0.146	Q9VWN9.pdb.gz	ZSWM8_DROME Zinc finger SWIM domain-containing protein 8 homolog OS=Drosophila melanogaster OX=7227 GN=Dora PE=2 SV=2
6	PDB:7dkhI	0.100	0.114	7.718E-5	914	0.080	0.104	7dkhI.pdb.gz
7	PDB:7sukSP	0.169	0.114	1.920E-4	2234	0.096	0.051	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
8	PDB:7mqaLM	0.124	0.090	2.806E-4	2041	0.098	0.057	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	PDB:7mq8LP	0.156	0.283	3.028E-4	567	0.056	0.116	7mq8LP.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	PDB:4bsmA	0.150	0.183	4.775E-4	896	0.083	0.109	4bsmA.pdb.gz
11	PDB:7mq8LM	0.127	0.089	5.558E-4	2005	0.097	0.057	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7sqcR1	0.114	0.077	5.773E-4	2080	0.089	0.050	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
13	PDB:7blnA	0.174	0.230	5.997E-4	769	0.090	0.139	7blnA.pdb.gz
14	AFDB:A0A1D8PK97	0.092	0.124	6.006E-4	751	0.063	0.100	A0A1D8PK97.pdb.gz	A0A1D8PK97_CANAL Chs4p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHS4 PE=4 SV=1
15	PDB:7ajuUT	0.120	0.082	6.720E-4	2313	0.106	0.054	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:4c0qA	0.117	0.147	6.980E-4	871	0.097	0.132	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
17	AFDB:Q9XVI2	0.119	0.152	2.102E-3	811	0.082	0.120	Q9XVI2.pdb.gz	Q9XVI2_CAEEL SYmmetrical Sister cell hermaphrodite gonad defect OS=Caenorhabditis elegans OX=6239 GN=sys-1 PE=1 SV=1
18	AFDB:Q4Q6K0	0.088	0.100	2.742E-3	1010	0.087	0.102	Q4Q6K0.pdb.gz	Q4Q6K0_LEIMA Mitochondrial RNA binding complex 1 subunit OS=Leishmania major OX=5664 GN=LMJF_31_0630 PE=4 SV=1
19	AFDB:Q95XZ5	0.129	0.090	3.073E-3	2176	0.074	0.040	Q95XZ5.pdb.gz	NIPBL_CAEEL Nipped-B-like protein scc-2 OS=Caenorhabditis elegans OX=6239 GN=scc-2 PE=1 SV=3
20	AFDB:J7SA49	0.091	0.071	4.164E-3	1768	0.117	0.079	J7SA49.pdb.gz	J7SA49_CAEEL ARID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=let-526 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80TB7	0.0	1725	1207	0.711	0.698	ZSWM6_MOUSE Zinc finger SWIM domain-containing protein 6 OS=Mus musculus OX=10090 GN=Zswim6 PE=1 SV=3
2	Q8C7B8	0.0	1432	1101	0.626	0.674	ZSWM4_MOUSE Zinc finger SWIM domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zswim4 PE=1 SV=2
3	Q9P217	0.0	2451	1185	1.000	1.000	ZSWM5_HUMAN Zinc finger SWIM domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZSWIM5 PE=2 SV=2
4	Q3UHH1	9.81e-48	189	1832	0.098	0.063	ZSWM8_MOUSE Zinc finger SWIM domain-containing protein 8 OS=Mus musculus OX=10090 GN=Zswim8 PE=1 SV=1
5	A7E2V4	1.08e-47	189	1837	0.098	0.063	ZSWM8_HUMAN Zinc finger SWIM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZSWIM8 PE=1 SV=1
6	Q9VWN9	4.90e-45	181	2103	0.105	0.059	ZSWM8_DROME Zinc finger SWIM domain-containing protein 8 homolog OS=Drosophila melanogaster OX=7227 GN=Dora PE=2 SV=2
7	Q21875	2.82e-23	110	1717	0.068	0.047	Q21875_CAEEL SWIM-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ebax-1 PE=1 SV=2
8	A0A024R693	0.050	39.3	250	0.021	0.100	A0A024R693_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
9	P17931	0.050	39.3	250	0.021	0.100	LEG3_HUMAN Galectin-3 OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=5
10	Q6NVH9	0.054	39.3	250	0.022	0.104	Q6NVH9_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=1
11	Q14008	0.098	39.7	2032	0.019	0.011	CKAP5_HUMAN Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5 PE=1 SV=3
12	P08699	0.17	37.7	262	0.020	0.092	LEG3_RAT Galectin-3 OS=Rattus norvegicus OX=10116 GN=Lgals3 PE=1 SV=4
13	O70458	0.28	37.7	971	0.016	0.020	OSMR_MOUSE Oncostatin-M-specific receptor subunit beta OS=Mus musculus OX=10090 GN=Osmr PE=1 SV=1
14	P16110	0.62	36.2	264	0.024	0.110	LEG3_MOUSE Galectin-3 OS=Mus musculus OX=10090 GN=Lgals3 PE=1 SV=3
15	P77432	0.97	35.8	530	0.026	0.058	LSRK_ECOLI Autoinducer-2 kinase OS=Escherichia coli (strain K12) OX=83333 GN=lsrK PE=1 SV=1
16	Q96EB1	1.6	35.0	424	0.042	0.118	ELP4_HUMAN Elongator complex protein 4 OS=Homo sapiens OX=9606 GN=ELP4 PE=1 SV=2
17	A0A1W2PR08	2.0	34.7	450	0.042	0.111	A0A1W2PR08_HUMAN Elongator complex protein 4 OS=Homo sapiens OX=9606 GN=ELP4 PE=1 SV=1
18	A0A1W2PNY5	2.4	34.7	386	0.042	0.130	A0A1W2PNY5_HUMAN Elongator complex protein 4 OS=Homo sapiens OX=9606 GN=ELP4 PE=1 SV=1
19	A0A1W2PQZ6	2.8	34.3	392	0.042	0.128	A0A1W2PQZ6_HUMAN Elongator complex protein 4 OS=Homo sapiens OX=9606 GN=ELP4 PE=1 SV=1
20	G5E9D4	3.6	34.3	535	0.042	0.093	G5E9D4_HUMAN Elongator complex protein 4 OS=Homo sapiens OX=9606 GN=ELP4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04434 SWIM	2.5e+02	12.8	SWIM zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352614

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381693	0.694	Zinc finger SWIM-type containing 8
2	9606.ENSP00000444856	0.655	Cullin-2
3	9606.ENSP00000291900	0.637	Protein zer-1 homolog
4	9606.ENSP00000399718	0.603	MAP3K12-binding inhibitory protein 1
5	9606.ENSP00000294353	0.600	Protein zyg-11 homolog B
6	9606.ENSP00000360583	0.593	Protein zyg-11 homolog A
7	9606.ENSP00000262306	0.587	Elongin-B
8	9606.ENSP00000367965	0.583	Ankyrin repeat domain-containing protein SOWAHA
9	9606.ENSP00000216225	0.551	E3 ubiquitin-protein ligase RBX1
10	9606.ENSP00000252744	0.545	Zinc finger SWIM-type containing 6
11	9606.ENSP00000254323	0.545	Zinc finger SWIM-type containing 4
12	9606.ENSP00000308236	0.540	COMM domain-containing protein 1
13	9606.ENSP00000321388	0.540	Ankyrin repeat and SOCS box protein 4
14	9606.ENSP00000359385	0.540	Glomulin
15	9606.ENSP00000383118	0.509	Cell division control protein 42 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.535	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0016043	0.967	cellular component organization
GO:0030030	0.948	cell projection organization
GO:0007399	0.947	nervous system development
GO:0032989	0.901	cellular component morphogenesis
GO:0048666	0.893	neuron development
GO:0120036	0.888	plasma membrane bounded cell projection organization
GO:0032990	0.884	cell part morphogenesis
GO:0000902	0.880	cell morphogenesis
GO:0031175	0.876	neuron projection development
GO:0048858	0.846	cell projection morphogenesis
GO:0120039	0.816	plasma membrane bounded cell projection morphogenesis
GO:0048812	0.810	neuron projection morphogenesis
GO:0048513	0.496	animal organ development
GO:0048518	0.495	positive regulation of biological process
GO:0007417	0.464	central nervous system development
GO:0007420	0.448	brain development
GO:0008152	0.387	metabolic process
GO:0048522	0.376	positive regulation of cellular process
GO:0019222	0.374	regulation of metabolic process
GO:0030334	0.359	regulation of cell migration
GO:0080090	0.357	regulation of primary metabolic process
GO:0051171	0.357	regulation of nitrogen compound metabolic process
GO:0031323	0.328	regulation of cellular metabolic process
GO:0030900	0.328	forebrain development
GO:0060255	0.308	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.995	cellular anatomical entity
GO:0043226	0.956	organelle
GO:0032991	0.946	protein-containing complex
GO:0005576	0.809	extracellular region
GO:1902494	0.799	catalytic complex
GO:1990234	0.794	transferase complex
GO:0005622	0.776	intracellular anatomical structure
GO:0000151	0.748	ubiquitin ligase complex
GO:0043227	0.741	membrane-bounded organelle
GO:0005737	0.675	cytoplasm
GO:0005615	0.610	extracellular space
GO:0043229	0.593	intracellular organelle
GO:0043231	0.467	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]