StarFunc result for job id Q9P218

User Input

>input (1284 residues)
MSSGDPAHLGLCLWLWLGATLGREQVQASGLLRLAVLPEDRLQMKWRESEGSGLGYLVQV
KPMAGDSEQEVILTTKTPKATVGGLSPSKGYTLQIFELTGSGRFLLARREFVIEDLKSSS
LDRSSQRPLGSGAPEPTPSHTGSPDPEQASEPQVAFTPSQDPRTPAGPQFRCLPPVPADM
VFLVDGSWSIGHSHFQQVKDFLASVIAPFEIGPDKVQVGLTQYSGDAQTEWDLNSLSTKE
QVLAAVRRLRYKGGNTFTGLALTHVLGQNLQPAAGLRPEAAKVVILVTDGKSQDDVHTAA
RVLKDLGVNVFAVGVKNADEAELRLLASPPRDITVHSVLDFLQLGALAGLLSRLICQRLQ
GGSPRQGPAAAPALDTLPAPTSLVLSQVTSSSIRLSWTPAPRHPLKYLIVWRASRGGTPR
EVVVEGPAASTELHNLASRTEYLVSVFPIYEGGVGEGLRGLVTTAPLPPPRALTLAAVTP
RTVHLTWQPSAGATHYLVRCSPASPKGEEEEREVQVGRPEVLLDGLEPGRDYEVSVQSLR
GPEGSEARGIRARTPTLAPPRHLGFSDVSHDAARVFWEGAPRPVRLVRVTYVSSEGGHSG
QTEAPGNATSATLGPLSSSTTYTVRVTCLYPGGGSSTLTGRVTTKKAPSPSQLSMTELPG
DAVQLAWVAAAPSGVLVYQITWTPLGEGKAHEISVPGNLGTAVLPGLGRHTEYDVTILAY
YRDGARSDPVSLRYTPSTVSRSPPSNLALASETPDSLQVSWTPPLGRVLHYWLTYAPASG
LGPEKSVSVPGARSHVTLPDLQAATKYRVLVSAIYAAGRSEAVSATGQTACPALRPDGSL
PGFDLMVAFSLVEKAYASIRGVAMEPSAFGGTPTFTLFKDAQLTRRVSDVYPAPLPPEHT
IVFLVRLLPETPREAFALWQMTAEDFQPLLGVLLDAGKKSLTYFHRDPRAALQEATFDPQ
EVRKIFFGSFHKVHVAVGRSKVRLYVDCRKVAERPLGEMGSPPAAGFVTLGRLAKARGPR
SSSAAFQLQMLQIVCSDTWADEDRCCELPASRDGETCPAFVSACSCSSETPGPPGPQGPP
GLPGRNGTPGEQGFPGPRGPPGVKGEKGDHGLPGLQGHPGHQGIPGRVGLQGPKGMRGLE
GTAGLPGPPGPRGFQGMAGARGTSGERGPPGTVGPTGLPGPKGERGEKGEPQSLATLYQL
VSQASHVSKFDSFHENTRPPMPILEQKLEPGTEPLGSPGTRSKALVPGEWGRGGRHLEGR
GEPGAVGQMGSPGQQGASTQGLWE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P218	0.999	0.999	0.000	1284	1.000	1.000	Q9P218.pdb.gz	COKA1_HUMAN Collagen alpha-1(XX) chain OS=Homo sapiens OX=9606 GN=COL20A1 PE=1 SV=4
2	AFDB:P07589	0.147	0.090	3.511E-35	2478	0.157	0.082	P07589.pdb.gz	FINC_BOVIN Fibronectin OS=Bos taurus OX=9913 GN=FN1 PE=1 SV=4
3	AFDB:B0S602	0.157	0.097	6.301E-35	2480	0.154	0.080	B0S602.pdb.gz	B0S602_DANRE Fibronectin OS=Danio rerio OX=7955 GN=Fn PE=1 SV=1
4	AFDB:Q9UQP3	0.114	0.113	1.515E-34	1299	0.125	0.123	Q9UQP3.pdb.gz	TENN_HUMAN Tenascin-N OS=Homo sapiens OX=9606 GN=TNN PE=1 SV=2
5	AFDB:P97603	0.119	0.112	1.425E-33	1377	0.114	0.106	P97603.pdb.gz	NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 GN=Neo1 PE=1 SV=1
6	AFDB:A0A0G2K1L0	0.140	0.103	4.756E-32	2019	0.125	0.079	A0A0G2K1L0.pdb.gz	A0A0G2K1L0_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=2
7	AFDB:Q4ZHG4	0.103	0.082	3.813E-26	1894	0.127	0.086	Q4ZHG4.pdb.gz	FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1 PE=2 SV=4
8	AFDB:Q9W213	0.095	0.092	5.623E-22	1395	0.121	0.111	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
9	AFDB:Q9Z2I4	0.082	0.078	1.725E-21	1366	0.134	0.126	Q9Z2I4.pdb.gz	ROBO3_MOUSE Roundabout homolog 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=2
10	AFDB:A0A2R8QRK0	0.085	0.077	2.911E-20	1420	0.123	0.111	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
11	PDB:4nenA	0.128	0.153	3.230E-16	1063	0.111	0.135	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
12	PDB:4nehA	0.125	0.147	5.724E-15	1084	0.107	0.126	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
13	PDB:8eyyA	0.126	0.183	1.734E-13	775	0.052	0.086	8eyyA.pdb.gz
14	PDB:6pxvA	0.123	0.173	2.439E-13	823	0.052	0.081	6pxvA.pdb.gz
15	PDB:8dtlA	0.126	0.191	1.982E-12	741	0.052	0.090	8dtlA.pdb.gz
16	PDB:6pyhD	0.126	0.178	1.392E-11	798	0.051	0.083	6pyhD.pdb.gz
17	PDB:4rtdA	0.077	0.085	2.719E-10	1122	0.063	0.072	4rtdA.pdb.gz
18	PDB:6h03A	0.105	0.109	7.941E-10	1223	0.051	0.054	6h03A.pdb.gz
19	PDB:7q1yA	0.104	0.099	9.650E-10	1374	0.065	0.060	7q1yA.pdb.gz
20	PDB:5a42A	0.119	0.099	1.649E-9	1597	0.082	0.066	5a42A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P218	0.0	2560	1284	1.000	1.000	COKA1_HUMAN Collagen alpha-1(XX) chain OS=Homo sapiens OX=9606 GN=COL20A1 PE=1 SV=4
2	F1S285	4.14e-141	473	1760	0.231	0.169	F1S285_PIG Collagen type XIV alpha 1 chain OS=Sus scrofa OX=9823 GN=COL14A1 PE=1 SV=3
3	Q05707	3.64e-134	454	1796	0.228	0.163	COEA1_HUMAN Collagen alpha-1(XIV) chain OS=Homo sapiens OX=9606 GN=COL14A1 PE=1 SV=3
4	Q80X19	3.94e-134	454	1797	0.224	0.160	COEA1_MOUSE Collagen alpha-1(XIV) chain OS=Mus musculus OX=10090 GN=Col14a1 PE=1 SV=2
5	F1R9Y1	6.66e-134	454	1864	0.220	0.151	F1R9Y1_DANRE Collagen alpha-1(XIV) chain isoform X2 OS=Danio rerio OX=7955 GN=col14a1a PE=1 SV=1
6	Q99715	7.29e-123	424	3063	0.194	0.081	COCA1_HUMAN Collagen alpha-1(XII) chain OS=Homo sapiens OX=9606 GN=COL12A1 PE=1 SV=2
7	Q60847	3.55e-120	416	3120	0.198	0.081	COCA1_MOUSE Collagen alpha-1(XII) chain OS=Mus musculus OX=10090 GN=Col12a1 PE=2 SV=3
8	F1SKM1	6.63e-63	239	2938	0.178	0.078	F1SKM1_PIG Collagen type VII alpha 1 chain OS=Sus scrofa OX=9823 GN=COL7A1 PE=4 SV=2
9	Q02388	8.03e-63	239	2944	0.179	0.078	CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens OX=9606 GN=COL7A1 PE=1 SV=2
10	Q63870	8.82e-61	232	2944	0.171	0.075	CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus OX=10090 GN=Col7a1 PE=1 SV=3
11	F5GZK2	3.44e-36	151	956	0.112	0.151	F5GZK2_HUMAN Collagen type XXI alpha 1 chain OS=Homo sapiens OX=9606 GN=COL21A1 PE=1 SV=2
12	A0A158RFW1	1.41e-35	149	957	0.114	0.153	A0A158RFW1_HUMAN Alpha 1 type XXI collagen OS=Homo sapiens OX=9606 GN=COL21A1 PE=4 SV=1
13	Q96P44	1.41e-35	149	957	0.114	0.153	COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens OX=9606 GN=COL21A1 PE=2 SV=1
14	Q8NFW1	2.73e-33	142	1626	0.058	0.046	COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens OX=9606 GN=COL22A1 PE=2 SV=2
15	P21941	3.82e-32	134	496	0.060	0.155	MATN1_HUMAN Cartilage matrix protein OS=Homo sapiens OX=9606 GN=MATN1 PE=1 SV=1
16	P51942	4.51e-32	134	500	0.056	0.144	MATN1_MOUSE Cartilage matrix protein OS=Mus musculus OX=10090 GN=Matn1 PE=2 SV=2
17	E1BMV3	7.72e-32	133	497	0.055	0.143	E1BMV3_BOVIN Matrilin 1 OS=Bos taurus OX=9913 GN=MATN1 PE=4 SV=3
18	E9Q7P1	3.77e-31	135	1613	0.057	0.045	E9Q7P1_MOUSE Collagen, type XXII, alpha 1 OS=Mus musculus OX=10090 GN=Col22a1 PE=1 SV=1
19	O08746	9.69e-31	134	956	0.057	0.076	MATN2_MOUSE Matrilin-2 OS=Mus musculus OX=10090 GN=Matn2 PE=2 SV=2
20	F1S0M0	1.52e-30	133	879	0.056	0.082	F1S0M0_PIG Matrilin 2 OS=Sus scrofa OX=9823 GN=MATN2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01391 Collagen	1e-13	62.1	Collagen triple helix repeat (20 copies)
2	PF16323 DUF4959	1.5e+02	14.1	Domain of unknown function (DUF4959)
3	PF00041 fn3	3.1e-69	240.7	Fibronectin type III domain
4	PF16656 Pur_ac_phosph_N	1.3e-05	37.1	Purple acid Phosphatase, N-terminal domain
5	PF00092 VWA	7.9e-44	161.5	von Willebrand factor type A domain
6	PF13519 VWA_2	5.2e-11	54.5	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351767

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401749	0.941	Prolyl 4-hydroxylase subunit alpha-3
2	9606.ENSP00000384999	0.913	Prolyl 4-hydroxylase subunit alpha-2
3	9606.ENSP00000263556	0.911	Prolyl 4-hydroxylase subunit alpha-1
4	9606.ENSP00000236040	0.762	Prolyl 3-hydroxylase 1
5	9606.ENSP00000323696	0.752	Cartilage-associated protein
6	9606.ENSP00000434412	0.723	Serpin H1
7	9606.ENSP00000282903	0.715	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
8	9606.ENSP00000252599	0.653	Procollagen galactosyltransferase 1
9	9606.ENSP00000223127	0.650	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
10	9606.ENSP00000316881	0.646	Prolyl 3-hydroxylase 2
11	9606.ENSP00000478600	0.646	Prolyl 3-hydroxylase 3
12	9606.ENSP00000196061	0.645	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
13	9606.ENSP00000354960	0.643	Procollagen galactosyltransferase 2
14	9606.ENSP00000300026	0.640	Peptidyl-prolyl cis-trans isomerase B
15	9606.ENSP00000320219	0.620	Arylsulfatase family member J
16	9606.ENSP00000359942	0.620	Kelch-like protein 31
17	9606.ENSP00000327801	0.619	Protein disulfide-isomerase
18	9606.ENSP00000361014	0.589	MAP kinase-interacting serine/threonine-protein kinase 1
19	9606.ENSP00000347649	0.588	Endoplasmic reticulum protein SC65
20	9606.ENSP00000272133	0.567	Protein cornichon homolog 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.907	structural molecule activity
GO:0005201	0.361	extracellular matrix structural constituent

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0032501	0.724	multicellular organismal process
GO:0050789	0.607	regulation of biological process
GO:0032502	0.606	developmental process
GO:0071840	0.549	cellular component organization or biogenesis
GO:0048856	0.546	anatomical structure development
GO:0016043	0.530	cellular component organization
GO:0007275	0.403	multicellular organism development
GO:0043062	0.386	extracellular structure organization
GO:0045229	0.385	external encapsulating structure organization
GO:0030198	0.368	extracellular matrix organization
GO:0050794	0.366	regulation of cellular process
GO:0050896	0.346	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0062023	0.997	collagen-containing extracellular matrix
GO:0005788	0.997	endoplasmic reticulum lumen
GO:0005615	0.600	extracellular space
GO:0070062	0.366	extracellular exosome
GO:0031981	0.312	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]