StarFunc result for job id Q9P219

User Input

>input (2028 residues)
MDVTVSELLELFLQSPLVTWVKTFGPFGSGSQDNLTMYMDLVDGIFLNQIMLQIDPRPTN
QRINKHVNNDVNLRIQNLTILVRNIKTYYQEVLQQLIVMNLPNVLMIGRDPLSGKSMEEI
KKVLLLVLGCAVQCERKEEFIERIKQLDIETQAGIVAHIQEVTHNQENVFDLQWLELPDV
APEELEALSRSMVLHLRRLIDQRDECTELIVDLTQERDYLQAQHPPSPIKSSSADSTPSP
TSSLSSEDKQHLAVELADTKARLRRVRQELEDKTEQLVDTRHEVDQLVLELQKVKQENIQ
LAADARSARAYRDELDSLREKANRVERLELELTRCKEKLHDVDFYKARMEELREDNIILI
ETKAMLEEQLTAARARGDKVHELEKENLQLKSKLHDLELDRDTDKKRIEELLEENMVLEI
AQKQSMNESAHLGWELEQLSKNADLSDASRKSFVFELNECASSRILKLEKENQSLQSTIQ
GLRDASLVLEESGLKCGELEKENHQLSKKIEKLQTQLEREKQSNQDLETLSEELIREKEQ
LQSDMETLKADKARQIKDLEQEKDHLNRAMWSLRERSQVSSEARMKDVEKENKALHQTVT
EANGKLSQLEFEKRQLHRDLEQAKEKGERAEKLERELQRLQEENGRLARKVTSLETATEK
VEALEHESQGLQLENRTLRKSLDTLQNVSLQLEGLERDNKQLDAENLELRRLVETMRFTS
TKLAQMERENQQLEREKEELRKNVDLLKALGKKSERLELSYQSVSAENLRLQQSLESSSH
KTQTLESELGELEAERQALRRDLEALRLANAQLEGAEKDRKALEQEVAQLEKDKKLLEKE
AKRLWQQVELKDAVLDDSTAKLSAVEKESRALDKELARCRDAAGKLKELEKDNRDLTKQV
TVHARTLTTLREDLVLEKLKSQQLSSELDKLSQELEKVGLNRELLLQEDDSGSDTKYKIL
EGRNESALKTTLAMKEEKIVLLEAQMEEKASLNRQLESELQMLKKECETLRQNQGEGQHL
QNSFKHPAGKTAASHQGKEAWGPGHKEATMELLRVKDRAIELERNNAALQAEKQLLKEQL
QHLETQNVTFSSQILTLQKQSAFLQEHNTTLQTQTAKLQVENSTLSSQSAALTAQYTLLQ
NHHTAKETENESLQRQQEQLTAAYEALLQDHEHLGTLHERQSAEYEALIRQHSCLKTLHR
NLELEHKELGERHGDMLKRKAELEEREKVLTTEREALQQEQRTNALAMGENQRLRGELDR
VNFLHHQLKGEYEELHAHTKELKTSLNNAQLELNRWQARFDELKEQHQTMDISLTKLDNH
CELLSRLKGNLEEENHHLLSQIQLLSQQNQMLLEQNMENKEQYHEEQKQYIDKLNALRRH
KEKLEEKIMDQYKFYDPPPKKKNHWIGAKALVKLIKPKKEGSRERLKSTVDSPPWQLESS
DPASPAASQPLRSQAENPDTPALGSNCAEERDAHNGSVGKGPGDLKPKRGSPHRGSLDRT
DASTDLAMRSWPSELGSRTCSTSATTTAPSNSTPIARHPGRTKGYNSDDNLCEPSLEFEV
PNHRQYVSRPSSLESSRNTSSNSSPLNLKGSSEQLHGRSESFSSEDLIPSRDLATLPREA
STPGRNALGRHEYPLPRNGPLPQEGAQKRGTAPPYVGVRPCSASPSSEMVTLEEFLEESN
RSSPTHDTPSCRDDLLSDYFRKASDPPAIGGQPGPPAKKEGAKMPTNFVAPTVKMAAPTS
EGRPLKPGQYVKPNFRLTEAEAPPSVAPRQAQPPQSLSLGRPRQAPVPPASHAPASRSAS
LSRAFSLASADLLRASGPEACKQESPQKLGAPEALGGRETGSHTLQSPAPPSSHSLARER
TPLVGKAGSSCQGPGPRSRPLDTRRFSLAPPKEERLAPLHQSATAPAIATAGAGAAAAGS
GSNSQLLHFSPAAAPAARTKPKAPPRSGEVATITPVRAGLSLSEGDGVPGQGCSEGLPAK
SPGRSPDLAPHLGRALEDCSRGSVSKSSPASPEPGGDPQTVWYEYGCV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QCI3	0.164	0.165	0.000	2023	0.524	0.525	A0A2R8QCI3.pdb.gz	DAPLE_DANRE Protein Daple OS=Danio rerio OX=7955 GN=ccdc88c PE=2 SV=1
2	AFDB:P85120	0.154	0.152	0.000	2058	0.581	0.572	P85120.pdb.gz	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1
3	AFDB:Q5SNZ0	0.140	0.148	0.000	1873	0.434	0.470	Q5SNZ0.pdb.gz	GRDN_MOUSE Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV=2
4	AFDB:Q6VGS5	0.172	0.173	0.000	2009	0.816	0.823	Q6VGS5.pdb.gz	DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1
5	AFDB:Q9P219	0.997	0.997	0.000	2028	1.000	1.000	Q9P219.pdb.gz	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
6	AFDB:F6ZDS4	0.054	0.047	2.026E-18	2431	0.189	0.158	F6ZDS4.pdb.gz	TPR_MOUSE Nucleoprotein TPR OS=Mus musculus OX=10090 GN=Tpr PE=1 SV=1
7	AFDB:A1Z8P9	0.060	0.053	9.676E-16	2346	0.184	0.159	A1Z8P9.pdb.gz	TPR_DROME Nucleoprotein TPR OS=Drosophila melanogaster OX=7227 GN=Mtor PE=1 SV=1
8	AFDB:E9Q7G0	0.063	0.061	7.862E-15	2094	0.183	0.177	E9Q7G0.pdb.gz	NUMA1_MOUSE Nuclear mitotic apparatus protein 1 OS=Mus musculus OX=10090 GN=Numa1 PE=1 SV=1
9	AFDB:Q14980	0.057	0.056	5.062E-14	2115	0.188	0.180	Q14980.pdb.gz	NUMA1_HUMAN Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2
10	AFDB:Q5EE04	0.043	0.043	1.361E-13	1997	0.167	0.169	Q5EE04.pdb.gz	TPR_XENLA Nucleoprotein TPR (Fragment) OS=Xenopus laevis OX=8355 GN=tpr PE=1 SV=1
11	PDB:1keyB	0.041	0.186	1.907E-1	221	0.012	0.109	1keyB.pdb.gz
12	PDB:7v2wF	0.033	0.074	3.833E-1	593	0.017	0.057	7v2wF.pdb.gz
13	PDB:7qpgW	0.032	0.062	4.063E-1	779	0.012	0.032	7qpgW.pdb.gz
14	PDB:6ikoA	0.026	0.103	4.564E-1	303	0.018	0.119	6ikoA.pdb.gz
15	PDB:7oqzA	0.038	0.156	4.564E-1	237	0.015	0.127	7oqzA.pdb.gz
16	PDB:5vb2D	0.035	0.162	5.128E-1	268	0.018	0.134	5vb2D.pdb.gz
17	PDB:6exnO	0.023	0.094	6.860E-1	320	0.022	0.141	6exnO.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
18	PDB:7tveD	0.020	0.075	6.860E-1	445	0.011	0.049	7tveD.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
19	PDB:7vdvW	0.024	0.165	6.860E-1	248	0.021	0.169	7vdvW.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
20	PDB:1huwA	0.037	0.213	7.706E-1	166	0.009	0.114	1huwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QCI3	0.0	1825	2023	0.539	0.541	DAPLE_DANRE Protein Daple OS=Danio rerio OX=7955 GN=ccdc88c PE=2 SV=1
2	A0A8I5ZW24	0.0	1562	1845	0.431	0.474	A0A8I5ZW24_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=4 SV=1
3	A0A8I6A5W7	0.0	1553	1873	0.434	0.470	A0A8I6A5W7_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=4 SV=1
4	D3ZYD7	0.0	1105	1523	0.328	0.437	D3ZYD7_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=1 SV=4
5	P85120	0.0	2076	2058	0.577	0.569	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1
6	Q3V6T2	0.0	1541	1871	0.445	0.483	GRDN_HUMAN Girdin OS=Homo sapiens OX=9606 GN=CCDC88A PE=1 SV=2
7	Q5SNZ0	0.0	1548	1873	0.433	0.469	GRDN_MOUSE Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV=2
8	Q6VGS5	0.0	3240	2009	0.823	0.831	DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1
9	Q9P219	0.0	4110	2028	1.000	1.000	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
10	M9PE55	1.14e-75	280	1346	0.125	0.188	M9PE55_DROME Girdin, isoform E OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
11	M9PDY5	1.16e-75	281	1380	0.125	0.183	M9PDY5_DROME Girdin, isoform C OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
12	Q9VZT7	1.27e-75	280	1381	0.125	0.183	Q9VZT7_DROME Girdin, isoform A OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
13	M9PEG0	3.44e-74	275	1236	0.125	0.205	M9PEG0_DROME Girdin, isoform D OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
14	Q8SX64	4.82e-74	274	1235	0.125	0.205	Q8SX64_DROME Girdin, isoform B OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
15	Q4QRL3	2.23e-61	235	1481	0.113	0.155	CC88B_MOUSE Coiled-coil domain-containing protein 88B OS=Mus musculus OX=10090 GN=Ccdc88b PE=1 SV=2
16	A6NC98	3.39e-59	228	1476	0.096	0.132	CC88B_HUMAN Coiled-coil domain-containing protein 88B OS=Homo sapiens OX=9606 GN=CCDC88B PE=1 SV=1
17	Q86VS8	4.93e-26	119	718	0.070	0.198	HOOK3_HUMAN Protein Hook homolog 3 OS=Homo sapiens OX=9606 GN=HOOK3 PE=1 SV=2
18	Q8BUK6	1.79e-25	117	718	0.071	0.199	HOOK3_MOUSE Protein Hook homolog 3 OS=Mus musculus OX=10090 GN=Hook3 PE=1 SV=2
19	F3Y5P4	5.07e-21	103	1319	0.109	0.168	GRDN_CAEEL Girdin homolog OS=Caenorhabditis elegans OX=6239 GN=grdn-1 PE=1 SV=1
20	Q96ED9	1.05e-17	92.0	719	0.054	0.152	HOOK2_HUMAN Protein Hook homolog 2 OS=Homo sapiens OX=9606 GN=HOOK2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19047 HOOK_N	7.1e-19	79.4	HOOK domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374507

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368169	0.994	Segment polarity protein dishevelled homolog DVL-1
2	9606.ENSP00000358867	0.856	Guanine nucleotide-binding protein G(k) subunit alpha
3	9606.ENSP00000005340	0.813	Segment polarity protein dishevelled homolog DVL-2
4	9606.ENSP00000316054	0.711	Segment polarity protein dishevelled homolog DVL-3
5	9606.ENSP00000350071	0.682	Striatin-3
6	9606.ENSP00000286201	0.652	Frizzled-7
7	9606.ENSP00000343223	0.632	T-cell leukemia/lymphoma protein 1B
8	9606.ENSP00000348460	0.598	Neuronal PAS domain-containing protein 3
9	9606.ENSP00000343001	0.591	Ubiquitin conjugation factor E4 B
10	9606.ENSP00000444957	0.582	AP-1 complex subunit sigma-2
11	9606.ENSP00000439807	0.579	Multiple PDZ domain protein
12	9606.ENSP00000306105	0.571	Centrosomal protein of 89 kDa
13	9606.ENSP00000263925	0.548	E3 ubiquitin-protein ligase LNX
14	9606.ENSP00000428402	0.543	Clavesin-1
15	9606.ENSP00000380999	0.538	Zinc finger protein 846
16	9606.ENSP00000249923	0.536	Coatomer subunit beta
17	9606.ENSP00000300504	0.525	TBC1 domain family member 21
18	9606.ENSP00000476253	0.518	Serine/arginine repetitive matrix 5
19	9606.ENSP00000432586	0.514	Protocadherin Fat 3
20	9606.ENSP00000247977	0.508	F-box/LRR-repeat protein 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	0.996	guanyl-nucleotide exchange factor activity
GO:0005102	0.840	signaling receptor binding
GO:0005109	0.804	frizzled binding
GO:0001965	0.768	G-protein alpha-subunit binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0050896	0.933	response to stimulus
GO:0048856	0.904	anatomical structure development
GO:0007165	0.890	signal transduction
GO:0019222	0.774	regulation of metabolic process
GO:0035556	0.769	intracellular signal transduction
GO:0031323	0.660	regulation of cellular metabolic process
GO:0048519	0.644	negative regulation of biological process
GO:0009888	0.635	tissue development
GO:0060429	0.620	epithelium development
GO:0023051	0.618	regulation of signaling
GO:0048583	0.592	regulation of response to stimulus
GO:0048523	0.585	negative regulation of cellular process
GO:0051171	0.560	regulation of nitrogen compound metabolic process
GO:0032501	0.559	multicellular organismal process
GO:0080090	0.559	regulation of primary metabolic process
GO:0060255	0.543	regulation of macromolecule metabolic process
GO:0010646	0.533	regulation of cell communication
GO:0009966	0.496	regulation of signal transduction
GO:0048518	0.450	positive regulation of biological process
GO:0007264	0.450	small GTPase mediated signal transduction
GO:0048522	0.433	positive regulation of cellular process
GO:0009653	0.410	anatomical structure morphogenesis
GO:0007166	0.409	cell surface receptor signaling pathway
GO:0016055	0.356	Wnt signaling pathway
GO:0009893	0.344	positive regulation of metabolic process
GO:0010604	0.331	positive regulation of macromolecule metabolic process
GO:0071840	0.324	cellular component organization or biogenesis
GO:0031325	0.320	positive regulation of cellular metabolic process
GO:0051173	0.312	positive regulation of nitrogen compound metabolic process
GO:0065008	0.304	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.987	cytosol
GO:0043229	0.839	intracellular organelle
GO:0016020	0.821	membrane
GO:0043227	0.813	membrane-bounded organelle
GO:0043231	0.802	intracellular membrane-bounded organelle
GO:0030054	0.715	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]