StarFunc result for job id Q9P225

User Input

>input (1400 residues)
MSSKAEKKQRLSGRGSSQASWSGRATRAAVATQEQGNAPAVSEPELQAELPKEEPEPRLE
GPQAQSEESVEPEADVKPLFLSRAALTGLADAVWTQEHDAILEHFAQDPTESILTIFIDP
CFGLKLELGMPVQTQNQLVYFIRQAPVPITWENFEATVQFGTVRGPYIPALLRLLGGVFA
PQIFANTGWPESIRNHFASHLHKFLACLTDTRYKLEGHTVLYIPAEAMNMKPEMVIKDKE
LVQRLETSMIHWTRQIKEMLSAQETVETGENLGPLEEIEFWRNRCMDLSGISKQLVKKGV
KHVESILHLAKSSYLAPFMKLAQQIQDGSRQAQSNLTFLSILKEPYQELAFMKPKDISSK
LPKLISLIRIIWVNSPHYNTRERLTSLFRKVCDCQYHFARWEDGKQGPLPCFFGAQGPQI
TRNLLEIEDIFHKNLHTLRAVRGGILDVKNTCWHEDYNKFRAGIKDLEVMTQNLITSAFE
LVRDVPHGVLLLDTFHRLASREAIKRTYDKKAVDLYMLFNSELALVNRERNKKWPDLEPY
VAQYSGKARWVHILRRRIDRVMTCLAGAHFLPRIGTGKESVHTYQQMVQAIDELVRKTFQ
EWTSSLDKDCIRRLDTPLLRISQEKAGMLDVNFDKSLLILFAEIDYWERLLFETPHYVVN
VAERAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKERIRLLDKKIHPGLKKLHWALK
GASAFFITECRIHASKVQMIVNEFKASTLTIGWRAQEMSEKLLVRISGKRVYRDLEFEED
QREHRAAVQQKLMNLHQDVVTIMTNSYEVFKNDGPEIQQQWMLYMIRLDRMMEDALRLNV
KWSLLELSKAINGDGKTSPNPLFQVLVILKNDLQGSVAQVEFSPTLQTLAGVVNDIGNHL
FSTISVFCHLPDILTKRKLHREPIQTVVEQDEDIKKIQTQISSGMTNNASLLQNYLKTWD
MYREIWEINKDSFIHRYQRLNPPVSSFVADIARYTEVANNVQKEETVTNIQFVLLDCSHL
KFSLVQHCNEWQNKFATLLREMAAGRLLELHTYLKENAEKISRPPQTLEELGVSLQLVDA
LKHDLANVETQIPPIHEQFAILEKYEVPVEDSVLEMLDSLNGEWVVFQQTLLDSKQMLKK
HKEKFKTGLIHSADDFKKKAHTLLEDFEFKGHFTSNVGYMSALDQITQVRAMLMAMREEE
NSLRANLGIFKIEQPPSKDLQNLEKELDALQQIWEIARDWEENWNEWKTGRFLILQTETM
ETTAHGLFRRLTKLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVR
DEIQREFDQESESFTLEQIVELGMDQHVEKIGEISASATKELAIEVALQNIAKTWDVTQL
DIVPYKDKGHHRLRGTEEVF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7z8fe	0.210	0.080	8.401E-33	4579	0.155	0.047	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
2	AFDB:Q9VN30	0.306	0.379	6.261E-21	1079	0.082	0.107	Q9VN30.pdb.gz	Q9VN30_DROME Dynein heavy chain linker domain-containing protein OS=Drosophila melanogaster OX=7227 GN=sac PE=4 SV=3
3	AFDB:A0A0R4IUQ6	0.200	0.388	3.766E-15	614	0.079	0.181	A0A0R4IUQ6.pdb.gz
4	PDB:7z8jf	0.153	0.280	1.755E-8	674	0.066	0.138	7z8jf.pdb.gz
5	AFDB:Q5SX07	0.162	0.376	3.795E-7	457	0.061	0.188	Q5SX07.pdb.gz	Q5SX07_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
6	AFDB:P11277	0.080	0.063	1.827E-3	2137	0.124	0.081	P11277.pdb.gz	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
7	PDB:7ay1A	0.060	0.075	4.372E-3	1033	0.084	0.114	7ay1A.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
8	PDB:3s4wB	0.068	0.077	5.393E-3	1146	0.086	0.106	3s4wB.pdb.gz
9	PDB:7dkhI	0.053	0.077	5.624E-3	914	0.096	0.147	7dkhI.pdb.gz
10	PDB:6vaeA	0.072	0.080	8.206E-3	1198	0.086	0.100	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
11	PDB:6zwmB	0.065	0.050	8.206E-3	2185	0.124	0.079	6zwmB.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.
12	PDB:6tedQ	0.057	0.081	1.148E-2	890	0.080	0.126	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
13	PDB:6tc0C	0.064	0.083	1.416E-2	994	0.098	0.138	6tc0C.pdb.gz
14	PDB:7sqcR1	0.065	0.051	1.747E-2	2080	0.104	0.070	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	AFDB:Q10435	0.066	0.061	3.173E-2	1647	0.076	0.065	Q10435.pdb.gz	YDE1_SCHPO Probable ubiquitin fusion degradation protein C12B10.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC12B10.01c PE=3 SV=2
16	AFDB:Q62717	0.069	0.072	5.477E-2	1289	0.049	0.053	Q62717.pdb.gz	CAPS1_RAT Calcium-dependent secretion activator 1 OS=Rattus norvegicus OX=10116 GN=Cadps PE=1 SV=1
17	AFDB:P33202	0.061	0.058	6.212E-2	1483	0.087	0.082	P33202.pdb.gz	UFD4_YEAST Ubiquitin fusion degradation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UFD4 PE=1 SV=1
18	AFDB:Q54XY4	0.050	0.046	7.663E-2	1582	0.074	0.066	Q54XY4.pdb.gz	SCAA_DICDI Sca1 complex scaffold protein scaA OS=Dictyostelium discoideum OX=44689 GN=scaA PE=1 SV=1
19	AFDB:A2RV69	0.064	0.084	8.334E-2	916	0.089	0.135	A2RV69.pdb.gz	A2RV69_XENLA Nuclear pore complex protein OS=Xenopus laevis OX=8355 GN=nup107.S PE=1 SV=1
20	AFDB:Q03609	0.059	0.071	1.118E-1	983	0.081	0.115	Q03609.pdb.gz	CLAP3_CAEEL Protein CLASP-3 OS=Caenorhabditis elegans OX=6239 GN=cls-3 PE=3 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C6F1	0.0	2423	4456	0.841	0.264	DYH2_MOUSE Dynein axonemal heavy chain 2 OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1
2	Q9MBF8	0.0	639	4513	0.249	0.077	DYH1B_CHLRE Dynein-1-beta heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC10 PE=1 SV=1
3	Q9P225	0.0	2899	4427	1.000	0.316	DYH2_HUMAN Dynein axonemal heavy chain 2 OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3
4	Q9GPN8	1.28e-116	408	4167	0.197	0.066	Q9GPN8_DROME 1-beta dynein (Fragment) OS=Drosophila melanogaster OX=7227 GN=kl-2 PE=2 SV=1
5	Q5LJP0	7.61e-116	406	4459	0.196	0.062	Q5LJP0_DROME Male fertility factor kl2 OS=Drosophila melanogaster OX=7227 GN=kl-2 PE=3 SV=5
6	Q57YY8	9.38e-92	332	4674	0.185	0.055	Q57YY8_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28L1.260 PE=4 SV=1
7	Q9SMH3	4.48e-73	273	4625	0.221	0.067	DYH1A_CHLRE Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1 PE=1 SV=1
8	Q39575	5.50e-52	204	4485	0.147	0.046	DYHG_CHLRE Dynein gamma chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 GN=ODA2 PE=1 SV=1
9	D3YYQ8	8.51e-51	201	4591	0.200	0.061	D3YYQ8_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
10	E7FGT8	6.33e-44	178	4626	0.160	0.048	E7FGT8_DANRE Dynein heavy chain 10, axonemal OS=Danio rerio OX=7955 GN=si:dkeyp-86b9.1 PE=1 SV=2
11	Q9UFH2	6.20e-41	168	4462	0.159	0.050	DYH17_HUMAN Dynein axonemal heavy chain 17 OS=Homo sapiens OX=9606 GN=DNAH17 PE=1 SV=3
12	Q96DT5	3.67e-35	149	4516	0.208	0.064	DYH11_HUMAN Dynein axonemal heavy chain 11 OS=Homo sapiens OX=9606 GN=DNAH11 PE=1 SV=4
13	Q57WX6	5.08e-35	149	4639	0.142	0.043	Q57WX6_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.490 PE=4 SV=1
14	Q9NYC9	1.45e-34	147	4486	0.141	0.044	DYH9_HUMAN Dynein axonemal heavy chain 9 OS=Homo sapiens OX=9606 GN=DNAH9 PE=1 SV=3
15	F7ABZ6	4.32e-34	146	4534	0.133	0.041	F7ABZ6_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
16	Q386I6	7.44e-34	145	4658	0.141	0.042	Q386I6_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0760 PE=4 SV=1
17	B1AR51	1.62e-33	144	4484	0.142	0.044	B1AR51_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
18	Q96JB1	2.02e-33	144	4490	0.073	0.023	DYH8_HUMAN Dynein axonemal heavy chain 8 OS=Homo sapiens OX=9606 GN=DNAH8 PE=1 SV=2
19	Q69Z23	6.10e-33	142	4481	0.144	0.045	DYH17_MOUSE Dynein axonemal heavy chain 17 OS=Mus musculus OX=10090 GN=Dnah17 PE=1 SV=2
20	A0A0B4KHJ4	1.01e-31	138	4496	0.139	0.043	A0A0B4KHJ4_DROME Dynein heavy chain at 93AB, isoform C OS=Drosophila melanogaster OX=7227 GN=Dhc93AB PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20276 CTD1	3.3e+02	12.1	C-terminal domain 1 of the ABC-three component (ABC-3C) systems
2	PF08385 DHC_N1	6.7e-107	370.2	Dynein heavy chain, N-terminal region 1
3	PF08393 DHC_N2	1.3e-38	144.7	Dynein heavy chain, N-terminal region 2
4	PF01628 HrcA	1.3e+02	13.8	HrcA protein C terminal domain
5	PF00435 Spectrin	1.3e+02	14.5	Spectrin repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000458355

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000294664	0.916	WD repeat-containing protein 63
2	9606.ENSP00000333363	0.916	Dynein heavy chain 8, axonemal
3	9606.ENSP00000374490	0.912	Dynein heavy chain 17, axonemal
4	9606.ENSP00000310829	0.905	Cilia- and flagella-associated protein 70
5	9606.ENSP00000354791	0.873	Dynactin subunit 1
6	9606.ENSP00000408910	0.865	Dynactin subunit 2
7	9606.ENSP00000400252	0.847	Dynein intermediate chain 2, axonemal
8	9606.ENSP00000254286	0.820	Actin related protein 10 homolog
9	9606.ENSP00000289228	0.820	Beta-centractin
10	9606.ENSP00000358921	0.820	Alpha-centractin
11	9606.ENSP00000414906	0.807	Dynactin subunit 4
12	9606.ENSP00000334002	0.804	Huntingtin-associated protein 1
13	9606.ENSP00000259632	0.803	Dynactin subunit 3
14	9606.ENSP00000300087	0.801	Dynactin subunit 5
15	9606.ENSP00000221114	0.800	Dynactin subunit 6
16	9606.ENSP00000480538	0.791	Dynein intermediate chain 1, axonemal
17	9606.ENSP00000452037	0.785	Dynein light chain 1, axonemal
18	9606.ENSP00000318429	0.771	Coiled-coil domain-containing protein 114
19	9606.ENSP00000401514	0.764	Dynein heavy chain 1, axonemal
20	9606.ENSP00000265104	0.761	Dynein heavy chain 5, axonemal

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003777	1.000	microtubule motor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007017	0.990	microtubule-based process
GO:0060271	0.484	cilium assembly
GO:0000226	0.458	microtubule cytoskeleton organization
GO:0001578	0.406	microtubule bundle formation
GO:0070286	0.349	axonemal dynein complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005858	0.999	axonemal dynein complex
GO:0031514	0.996	motile cilium
GO:0097729	0.788	9+2 motile cilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]