StarFunc result for job id Q9P227

User Input

>input (1491 residues)
MNGVAFCLVGIPPRPEPRPPQLPLGPRDGCSPRRPFPWQGPRTLLLYKSPQDGFGFTLRH
FIVYPPESAVHCSLKEEENGGRGGGPSPRYRLEPMDTIFVKNVKEDGPAHRAGLRTGDRL
VKVNGESVIGKTYSQVIALIQNSDDTLELSIMPKDEDILQLAYSQDAYLKGNEPYSGEAR
SIPEPPPICYPRKTYAPPARASTRATMVPEPTSALPSDPRSPAAWSDPGLRVPPAARAHL
DNSSLGMSQPRPSPGAFPHLSSEPRTPRAFPEPGSRVPPSRLECQQALSHWLSNQVPRRA
GERRCPAMAPRARSASQDRLEEVAAPRPWPCSTSQDALSQLGQEGWHRARSDDYLSRATR
SAEALGPGALVSPRFERCGWASQRSSARTPACPTRDLPGPQAPPPSGLQGLDDLGYIGYR
SYSPSFQRRTGLLHALSFRDSPFGGLPTFNLAQSPASFPPEASEPPRVVRPEPSTRALEP
PAEDRGDEVVLRQKPPTGRKVQLTPARQMNLGFGDESPEPEASGRGERLGRKVAPLATTE
DSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSSPTFTFTLGRHYSQD
CSSIKAGRRSSYLLAITTERSKSCDDGLNTFRDEGRVLRRLPNRIPSLRMLRSFFTDGSL
DSWGTSEDADAPSKRHSTSDLSDATFSDIRREGWLYYKQILTKKGKKAGSGLRQWKRVYA
ALRARSLSLSKERREPGPAAAGAAAAGAGEDEAAPVCIGSCLVDISYSETKRRHVFRLTT
ADFCEYLFQAEDRDDMLGWIRAIRENSRAEGEDPGCANQALISKKLNDYRKVSHSSGPKA
DSSPKGSRGLGGLKSEFLKQSAARGLRTQDLPAGSKDDSAAAPKTPWGINIIKKNKKAAP
RAFGVRLEECQPATENQRVPLIVAACCRIVEARGLESTGIYRVPGNNAVVSSLQEQLNRG
PGDINLQDERWQDLNVISSLLKSFFRKLPEPLFTDDKYNDFIEANRIEDARERMRTLRKL
IRDLPGHYYETLKFLVGHLKTIADHSEKNKMEPRNLALVFGPTLVRTSEDNMTDMVTHMP
DRYKIVETLIQHSDWFFSDEEDKGERTPVGDKEPQAVPNIEYLLPNIGRTVPPGDPGSDS
TTCSSAKSKGSWAPKKEPYAREMLAISFISAVNRKRKKRREARGLGSSTDDDSEQEAHKP
GAGATAPGTQERPQGPLPGAVAPEAPGRLSPPAAPEERPAADTRSIVSGYSTLSTMDRSV
CSGASGRRAGAGDEADDERSELSHVETDTEGAAGAGPGGRLTRRPSFSSHHLMPCDTLAR
RRLARGRPDGEGAGRGGPRAPEPPGSASSSSQESLRPPAAALASRPSRMEALRLRLRGTA
DDMLAVRLRRPLSPETRRRRSSWRRHTVVVQSPLTDLNFNEWKELGGGGPPEPAGARAHS
DNKDSGLSSLESTKARAPSSAASQPPAPGDTGSLQSQPPRRSAASRLHQCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P227	0.999	0.999	0.000	1491	1.000	1.000	Q9P227.pdb.gz	RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2
2	AFDB:Q6DFV3	0.238	0.192	2.826E-79	1944	0.444	0.341	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
3	AFDB:Q5T5U3	0.249	0.201	4.847E-74	1958	0.405	0.308	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
4	AFDB:X2JEI9	0.184	0.130	6.720E-39	2206	0.229	0.155	X2JEI9.pdb.gz	X2JEI9_DROME Rho GTPase activating protein at 19D, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
5	AFDB:Q5VT97	0.125	0.154	8.048E-17	1194	0.136	0.170	Q5VT97.pdb.gz	SYDE2_HUMAN Rho GTPase-activating protein SYDE2 OS=Homo sapiens OX=9606 GN=SYDE2 PE=1 SV=2
6	AFDB:Q5AMQ3	0.134	0.168	4.183E-16	1176	0.123	0.156	Q5AMQ3.pdb.gz	Q5AMQ3_CANAL Rga2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RGA2 PE=4 SV=1
7	PDB:3cxlA	0.131	0.468	7.096E-15	402	0.048	0.177	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
8	PDB:6r3vA	0.126	0.899	5.569E-14	198	0.040	0.298	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
9	PDB:1xa6A	0.127	0.457	4.370E-13	399	0.047	0.175	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
10	PDB:5c2kA	0.114	0.430	4.065E-11	382	0.043	0.168	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
11	AFDB:X2JC00	0.126	0.134	7.176E-11	1404	0.126	0.134	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
12	PDB:5jcpA	0.119	0.477	2.224E-10	361	0.034	0.141	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
13	AFDB:A0A0A0MRJ9	0.135	0.220	2.382E-9	890	0.103	0.172	A0A0A0MRJ9.pdb.gz	A0A0A0MRJ9_HUMAN Rho GTPase activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=1
14	AFDB:F4IZM8	0.060	0.064	3.245E-9	1347	0.131	0.145	F4IZM8.pdb.gz	HUAL3_ARATH Protein HUA2-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=HULK3 PE=2 SV=1
15	AFDB:Q9LEY4	0.059	0.057	3.597E-9	1445	0.128	0.132	Q9LEY4.pdb.gz	HUAL1_ARATH Protein HUA2-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=HULK1 PE=2 SV=1
16	PDB:3ljuX	0.064	0.228	1.614E-4	373	0.015	0.062	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
17	PDB:6hhgA	0.058	0.213	3.874E-4	386	0.016	0.062	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
18	PDB:7pcbA	0.059	0.198	5.556E-4	415	0.025	0.089	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:6bbpA	0.065	0.175	1.085E-3	520	0.016	0.046	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
20	PDB:6s9wA	0.059	0.200	1.203E-3	411	0.015	0.054	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T5U3	0.0	618	1958	0.241	0.183	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
2	Q6DFV3	0.0	623	1945	0.245	0.188	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
3	Q9P227	0.0	3009	1491	1.000	1.000	RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2
4	A0A087WW76	2.65e-117	404	1406	0.132	0.140	A0A087WW76_HUMAN Rho GTPase activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=1
5	J3JSM9	3.41e-117	404	1406	0.132	0.140	J3JSM9_HUMAN ARHGAP21 protein OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=1
6	P34288	1.39e-59	228	1605	0.072	0.067	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
7	X2JEI9	7.11e-43	174	2206	0.056	0.038	X2JEI9_DROME Rho GTPase activating protein at 19D, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
8	Q9VRA6	7.82e-43	174	2181	0.056	0.039	Q9VRA6_DROME Rho GTPase activating protein at 19D, isoform A OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=2
9	M9NFH4	8.48e-43	174	2135	0.056	0.039	M9NFH4_DROME Rho GTPase activating protein at 19D, isoform C OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
10	E1JJS2	8.71e-43	174	2109	0.056	0.040	E1JJS2_DROME Rho GTPase activating protein at 19D, isoform B OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
11	Q95TR0	1.01e-42	174	1553	0.056	0.054	Q95TR0_DROME LD29482p OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=2 SV=1
12	Q53QZ3	1.81e-39	156	475	0.080	0.253	RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens OX=9606 GN=ARHGAP15 PE=1 SV=2
13	Q6TLK4	1.63e-36	152	869	0.082	0.142	RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus OX=10116 GN=Arhgap27 PE=1 SV=1
14	Q8IWW6	2.19e-36	152	846	0.072	0.128	RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1
15	Q1RLN5	2.56e-36	151	799	0.072	0.135	Q1RLN5_HUMAN ARHGAP12 protein OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1
16	Q6ZUM4	4.14e-36	151	889	0.068	0.114	RHG27_HUMAN Rho GTPase-activating protein 27 OS=Homo sapiens OX=9606 GN=ARHGAP27 PE=1 SV=3
17	Q03070	2.22e-35	139	295	0.051	0.258	CHIO_RAT Beta-chimaerin OS=Rattus norvegicus OX=10116 GN=Chn2 PE=2 SV=1
18	P30337	3.39e-33	134	334	0.044	0.198	CHIN_RAT N-chimaerin OS=Rattus norvegicus OX=10116 GN=Chn1 PE=1 SV=2
19	P52757	1.75e-32	135	468	0.050	0.160	CHIO_HUMAN Beta-chimaerin OS=Homo sapiens OX=9606 GN=CHN2 PE=1 SV=2
20	Q91V57	4.49e-32	134	459	0.044	0.144	CHIN_MOUSE N-chimaerin OS=Mus musculus OX=10090 GN=Chn1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00595 PDZ	1.1e-06	40.2	PDZ domain
2	PF13180 PDZ_2	0.014	27.1	PDZ domain
3	PF17820 PDZ_6	3.9e-10	50.8	PDZ domain
4	PF02163 Peptidase_M50	0.44	21.3	Peptidase family M50
5	PF00169 PH	4.4e-06	38.5	PH domain
6	PF15410 PH_9	2.1e-10	52.2	Pleckstrin homology domain
7	PF00620 RhoGAP	2.5e-45	165.4	RhoGAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481862

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369592	0.879	Coiled-coil domain-containing protein 85C
2	9606.ENSP00000384040	0.858	Coiled-coil domain containing 85A
3	9606.ENSP00000328551	0.844	Ras-related protein Rab-28
4	9606.ENSP00000311695	0.823	Coiled-coil domain-containing protein 85B
5	9606.ENSP00000379047	0.801	Mitochondrial potassium channel located in the mitochondrial inner membrane . Together with ABCB8/MITOSUR, forms a protein complex localized in the mitochondria that mediates ATP- dependent potassium currents across the inner membrane (that is, mitoK(ATP) channel) . May contribute to the homeostatic control of cellular metabolism under stress conditions by regulating the mitochondrial matrix volume .
6	9606.ENSP00000375770	0.797	Zinc finger protein 541
7	9606.ENSP00000354451	0.695	Ras GTPase-activating-like protein IQGAP3
8	9606.ENSP00000264644	0.624	Rap guanine nucleotide exchange factor-like 1
9	9606.ENSP00000378289	0.599	Synaptopodin 2-like protein
10	9606.ENSP00000263563	0.593	Paladin
11	9606.ENSP00000320092	0.573	Endophilin-A3
12	9606.ENSP00000384192	0.573	Ras guanyl-releasing protein 3
13	9606.ENSP00000354837	0.571	Rho guanine nucleotide exchange factor 2
14	9606.ENSP00000338191	0.552	Beta-2-syntrophin
15	9606.ENSP00000298694	0.522	Rho guanine nucleotide exchange factor 40
16	9606.ENSP00000306772	0.520	LIM domain-binding protein 2
17	9606.ENSP00000338785	0.517	StAR-related lipid transfer protein 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005096	1.000	GTPase activator activity
GO:0005515	0.995	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0048583	0.979	regulation of response to stimulus
GO:0010646	0.968	regulation of cell communication
GO:0023051	0.967	regulation of signaling
GO:0009966	0.961	regulation of signal transduction
GO:0051056	0.930	regulation of small GTPase mediated signal transduction
GO:0009987	0.764	cellular process
GO:0050896	0.479	response to stimulus
GO:0051716	0.435	cellular response to stimulus
GO:0023052	0.422	signaling
GO:0007154	0.421	cell communication
GO:0007165	0.411	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005829	1.000	cytosol
GO:0031982	0.991	vesicle
GO:0005576	0.960	extracellular region
GO:0005615	0.911	extracellular space
GO:1903561	0.905	extracellular vesicle
GO:0070062	0.896	extracellular exosome
GO:0043229	0.885	intracellular organelle
GO:0016020	0.864	membrane
GO:0043231	0.727	intracellular membrane-bounded organelle
GO:0005886	0.457	plasma membrane
GO:0030054	0.407	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]