StarFunc result for job id Q9P232

User Input

>input (1028 residues)
MMFPWKQLILLSFIGCLGGELLLQGPVFIKEPSNSIFPVGSEDKKITLHCEARGNPSPHY
RWQLNGSDIDMSMEHRYKLNGGNLVVINPNRNWDTGTYQCFATNSLGTIVSREAKLQFAY
LENFKTKMRSTVSVREGQGVVLLCGPPPHSGELSYAWIFNEYPSFVEEDSRRFVSQETGH
LYISKVEPSDVGNYTCVVTSMVTNARVLGSPTPLVLRSDGVMGEYEPKIEVQFPETLPAA
KGSTVKLECFALGNPIPQINWRRSDGLPFSSKIKLRKFSGVLEIPNFQQEDAGSYECIAE
NSRGKNVARGRLTYYAKPHWVQLIKDVEIAVEDSLYWECRASGKPKPSYRWLKNGAALVL
EERTQIENGALTISNLSVTDSGMFQCIAENKHGLVYSSAELKVVASAPDFSKNPMKKLVQ
VQVGSLVSLDCKPRASPRALSSWKKGDVSVQEHERISLLNDGGLKIANVTKADAGTYTCM
AENQFGKANGTTHLVVTEPTRITLAPSNMDVSVGESVILPCQVQHDPLLDIIFTWYFNGA
LADFKKDGSHFEKVGGSSSGDLMIRNIQLKHSGKYVCMVQTGVDSVSSAADLIVRGSPGP
PENVKVDEITDTTAQLSWKEGKDNHSPVISYSIQARTPFSVGWQTVTTVPEVIDGKTHTA
TVVELNPWVEYEFRVVASNKIGGGEPSLPSEKVRTEEAVPEVPPSEVNGGGGSRSELVIT
WDPVPEELQNGEGFGYVVAFRPLGVTTWIQTVVTSPDTPRYVFRNESIVPYSPYEVKVGV
YNNKGEGPFSPVTTVFSAEEEPTVAPSQVSANSLSSSEIEVSWNTIPWKLSNGHLLGYEV
RYWNGGGKEESSSKMKVAGNETSARLRGLKSNLAYYTAVRAYNSAGAGPFSATVNVTTKK
TPPSQPPGNVVWNATDTKVLLNWEQVKAMENESEVTGYKVFYRTSSQNNVQVLNTNKTSA
ELVLPIKEDYIIEVKATTDGGDGTSSEQIRIPRITSMDARGSTSAISNVHPMSSYMPIVL
FLIVYVLW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QA12	0.429	0.424	0.000	1040	0.400	0.395	A0A2R8QA12.pdb.gz
2	AFDB:A4JYP8	0.397	0.395	0.000	1032	0.398	0.396	A4JYP8.pdb.gz	A4JYP8_DANRE Cntn1a OS=Danio rerio OX=7955 GN=F3 PE=1 SV=1
3	AFDB:B3DH04	0.424	0.419	0.000	1040	0.433	0.428	B3DH04.pdb.gz
4	AFDB:O94779	0.451	0.423	0.000	1100	0.533	0.498	O94779.pdb.gz	CNTN5_HUMAN Contactin-5 OS=Homo sapiens OX=9606 GN=CNTN5 PE=1 SV=2
5	AFDB:P14781	0.386	0.392	0.000	1010	0.443	0.450	P14781.pdb.gz	CNTN1_CHICK Contactin-1 OS=Gallus gallus OX=9031 GN=CNTN1 PE=1 SV=1
6	AFDB:P22063	0.427	0.422	0.000	1040	0.428	0.423	P22063.pdb.gz	CNTN2_RAT Contactin-2 OS=Rattus norvegicus OX=10116 GN=Cntn2 PE=1 SV=1
7	AFDB:P28685	0.412	0.409	0.000	1036	0.446	0.443	P28685.pdb.gz	CNTN2_CHICK Contactin-2 OS=Gallus gallus OX=9031 GN=CNTN2 PE=1 SV=1
8	AFDB:P97528	0.403	0.403	0.000	1028	0.582	0.582	P97528.pdb.gz	CNTN6_RAT Contactin-6 OS=Rattus norvegicus OX=10116 GN=Cntn6 PE=1 SV=1
9	AFDB:Q62682	0.449	0.449	0.000	1028	0.906	0.906	Q62682.pdb.gz	CNTN3_RAT Contactin-3 OS=Rattus norvegicus OX=10116 GN=Cntn3 PE=1 SV=1
10	AFDB:Q62845	0.451	0.451	0.000	1026	0.642	0.643	Q62845.pdb.gz	CNTN4_RAT Contactin-4 OS=Rattus norvegicus OX=10116 GN=Cntn4 PE=1 SV=1
11	PDB:5oj2B	0.138	0.197	8.076E-30	692	0.134	0.199	5oj2B.pdb.gz
12	PDB:1e07A	0.157	0.217	5.186E-21	642	0.128	0.206	1e07A.pdb.gz
13	PDB:7sqcO0	0.137	0.130	1.344E-16	1140	0.093	0.084	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:5a42A	0.137	0.098	2.164E-14	1597	0.124	0.080	5a42A.pdb.gz
15	PDB:7q5zA	0.131	0.107	2.263E-14	1344	0.074	0.057	7q5zA.pdb.gz
16	PDB:8dtlA	0.144	0.189	2.834E-14	741	0.062	0.086	8dtlA.pdb.gz
17	PDB:6pxvA	0.142	0.171	3.243E-14	823	0.057	0.072	6pxvA.pdb.gz
18	PDB:7q1yA	0.110	0.089	1.250E-13	1374	0.082	0.061	7q1yA.pdb.gz
19	PDB:6dldD	0.122	0.359	1.637E-13	269	0.072	0.275	6dldD.pdb.gz
20	PDB:7vonA	0.131	0.101	2.566E-13	1399	0.086	0.063	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4JYP8	0.0	769	1032	0.401	0.399	A4JYP8_DANRE Cntn1a OS=Danio rerio OX=7955 GN=F3 PE=1 SV=1
2	O94779	0.0	1135	1100	0.527	0.493	CNTN5_HUMAN Contactin-5 OS=Homo sapiens OX=9606 GN=CNTN5 PE=1 SV=2
3	P12960	0.0	863	1020	0.425	0.428	CNTN1_MOUSE Contactin-1 OS=Mus musculus OX=10090 GN=Cntn1 PE=1 SV=1
4	P14781	0.0	884	1010	0.440	0.448	CNTN1_CHICK Contactin-1 OS=Gallus gallus OX=9031 GN=CNTN1 PE=1 SV=1
5	P22063	0.0	858	1040	0.433	0.428	CNTN2_RAT Contactin-2 OS=Rattus norvegicus OX=10116 GN=Cntn2 PE=1 SV=1
6	P28685	0.0	894	1036	0.446	0.443	CNTN2_CHICK Contactin-2 OS=Gallus gallus OX=9031 GN=CNTN2 PE=1 SV=1
7	P68500	0.0	1133	1098	0.532	0.498	CNTN5_MOUSE Contactin-5 OS=Mus musculus OX=10090 GN=Cntn5 PE=1 SV=2
8	P97528	0.0	1299	1028	0.581	0.581	CNTN6_RAT Contactin-6 OS=Rattus norvegicus OX=10116 GN=Cntn6 PE=1 SV=1
9	Q02246	0.0	862	1040	0.427	0.422	CNTN2_HUMAN Contactin-2 OS=Homo sapiens OX=9606 GN=CNTN2 PE=1 SV=1
10	Q12860	0.0	867	1018	0.424	0.428	CNTN1_HUMAN Contactin-1 OS=Homo sapiens OX=9606 GN=CNTN1 PE=1 SV=1
11	Q61330	0.0	857	1040	0.434	0.429	CNTN2_MOUSE Contactin-2 OS=Mus musculus OX=10090 GN=Cntn2 PE=1 SV=2
12	Q62682	0.0	1951	1028	0.907	0.907	CNTN3_RAT Contactin-3 OS=Rattus norvegicus OX=10116 GN=Cntn3 PE=1 SV=1
13	Q62845	0.0	1437	1026	0.645	0.646	CNTN4_RAT Contactin-4 OS=Rattus norvegicus OX=10116 GN=Cntn4 PE=1 SV=1
14	Q63198	0.0	862	1021	0.426	0.429	CNTN1_RAT Contactin-1 OS=Rattus norvegicus OX=10116 GN=Cntn1 PE=1 SV=2
15	Q8IWV2	0.0	1433	1026	0.646	0.647	CNTN4_HUMAN Contactin-4 OS=Homo sapiens OX=9606 GN=CNTN4 PE=1 SV=1
16	Q9JMB8	0.0	1303	1028	0.589	0.589	CNTN6_MOUSE Contactin-6 OS=Mus musculus OX=10090 GN=Cntn6 PE=1 SV=2
17	Q9P232	0.0	2115	1028	1.000	1.000	CNTN3_HUMAN Contactin-3 OS=Homo sapiens OX=9606 GN=CNTN3 PE=1 SV=3
18	Q9UQ52	0.0	1313	1028	0.591	0.591	CNTN6_HUMAN Contactin-6 OS=Homo sapiens OX=9606 GN=CNTN6 PE=1 SV=1
19	Q9W675	0.0	889	1040	0.432	0.427	Q9W675_DANRE Contactin-2 precursor OS=Danio rerio OX=7955 GN=tag1 PE=1 SV=1
20	Q9VN14	1.48e-148	479	1390	0.315	0.233	CONT_DROME Contactin OS=Drosophila melanogaster OX=7227 GN=Cont PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	26	16.0	Adenovirus E3 region protein CR1
2	PF05790 C2-set	2.4	19.7	Immunoglobulin C2-set domain
3	PF08205 C2-set_2	0.00088	30.6	CD80-like C2-set immunoglobulin domain
4	PF11327 Egh16-like	2.9e+02	13.3	Egh16-like virulence factor
5	PF00041 fn3	7.4e-41	149.7	Fibronectin type III domain
6	PF16893 fn3_2	1.4	20.4	Fibronectin type III domain
7	PF16794 fn3_4	1.9e+02	13.4	Fibronectin-III type domain
8	PF07679 I-set	6.6e-74	255.4	Immunoglobulin I-set domain
9	PF00047 ig	6e-55	194.7	Immunoglobulin domain
10	PF13895 Ig_2	2.4e-48	173.6	Immunoglobulin domain
11	PF13927 Ig_3	1.2e-73	255.0	Immunoglobulin domain
12	PF16680 Ig_4	0.12	24.3	T-cell surface glycoprotein CD3 delta chain
13	PF16681 Ig_5	4.5e-08	44.7	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
14	PF18452 Ig_6	0.085	24.1	Immunoglobulin domain
15	PF17736 Ig_C17orf99	0.0054	28.1	C17orf99 Ig domain
16	PF16656 Pur_ac_phosph_N	0.00017	33.5	Purple acid Phosphatase, N-terminal domain
17	PF01108 Tissue_fac	0.11	23.8	Tissue factor
18	PF07686 V-set	4.7e-24	96.0	Immunoglobulin V-set domain
19	PF08204 V-set_CD47	25	16.3	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263665

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000418112	0.966	Receptor-type tyrosine-protein phosphatase gamma
2	9606.ENSP00000284981	0.643	Amyloid-beta A4 protein
3	9606.ENSP00000354778	0.612	Contactin-associated protein-like 2
4	9606.ENSP00000270235	0.610	Plays a role in neurogenesis. Prevents motor neuron cell body migration out of the neural tube
5	9606.ENSP00000246841	0.587	Leucine-rich repeat transmembrane protein FLRT1
6	9606.ENSP00000285018	0.574	Protein Wnt-7a
7	9606.ENSP00000344829	0.569	Glutaminyl-peptide cyclotransferase
8	9606.ENSP00000264638	0.528	Contactin-associated protein 1
9	9606.ENSP00000479811	0.525	Contactin-associated protein-like 4
10	9606.ENSP00000399013	0.517	Contactin-associated protein-like 5
11	9606.ENSP00000297668	0.503	Contactin-associated protein-like 3
12	9606.ENSP00000386908	0.500	Multiple epidermal growth factor-like domains protein 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.649	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0032501	0.972	multicellular organismal process
GO:0007155	0.941	cell adhesion
GO:0007399	0.910	nervous system development
GO:0065007	0.900	biological regulation
GO:0050789	0.746	regulation of biological process
GO:0071840	0.663	cellular component organization or biogenesis
GO:0050794	0.642	regulation of cellular process
GO:0016043	0.629	cellular component organization
GO:0050896	0.543	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005576	0.977	extracellular region
GO:0043227	0.667	membrane-bounded organelle
GO:0005622	0.658	intracellular anatomical structure
GO:0043231	0.479	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]