StarFunc result for job id Q9P241

User Input

>input (1426 residues)
MTEALQWARYHWRRLIRGATRDDDSGPYNYSSLLACGRKSSQTPKLSGRHRIVVPHIQPF
KDEYEKFSGAYVNNRIRTTKYTLLNFVPRNLFEQFHRAANLYFLFLVVLNWVPLVEAFQK
EITMLPLVVVLTIIAIKDGLEDYRKYKIDKQINNLITKVYSRKEKKYIDRCWKDVTVGDF
IRLSCNEVIPADMVLLFSTDPDGICHIETSGLDGESNLKQRQVVRGYAEQDSEVDPEKFS
SRIECESPNNDLSRFRGFLEHSNKERVGLSKENLLLRGCTIRNTEAVVGIVVYAGHETKA
MLNNSGPRYKRSKLERRANTDVLWCVMLLVIMCLTGAVGHGIWLSRYEKMHFFNVPEPDG
HIISPLLAGFYMFWTMIILLQVLIPISLYVSIEIVKLGQIYFIQSDVDFYNEKMDSIVQC
RALNIAEDLGQIQYLFSDKTGTLTENKMVFRRCSVAGFDYCHEENARRLESYQEAVSEDE
DFIDTVSGSLSNMAKPRAPSCRTVHNGPLGNKPSNHLAGSSFTLGSGEGASEVPHSRQAA
FSSPIETDVVPDTRLLDKFSQITPRLFMPLDETIQNPPMETLYIIDFFIALAICNTVVVS
APNQPRQKIRHPSLGGLPIKSLEEIKSLFQRWSVRRSSSPSLNSGKEPSSGVPNAFVSRL
PLFSRMKPASPVEEEVSQVCESPQCSSSSACCTETEKQHGDAGLLNGKAESLPGQPLACN
LCYEAESPDEAALVYAARAYQCTLRSRTPEQVMVDFAALGPLTFQLLHILPFDSVRKRMS
VVVRHPLSNQVVVYTKGADSVIMELLSVASPDGASLEKQQMIVREKTQKHLDDYAKQGLR
TLCIAKKVMSDTEYAEWLRNHFLAETSIDNREELLLESAMRLENKLTLLGATGIEDRLQE
GVPESIEALHKAGIKIWMLTGDKQETAVNIAYACKLLEPDDKLFILNTQSKDACGMLMST
ILKELQKKTQALPEQVSLSEDLLQPPVPRDSGLRAGLIITGKTLEFALQESLQKQFLELT
SWCQAVVCCRATPLQKSEVVKLVRSHLQVMTLAIGDGANDVSMIQVADIGIGVSGQEGMQ
AVMASDFAVSQFKHLSKLLLVHGHWCYTRLSNMILYFFYKNVAYVNLLFWYQFFCGFSGT
SMTDYWVLIFFNLLFTSAPPVIYGVLEKDVSAETLMQLPELYRSGQKSEAYLPHTFWITL
LDAFYQSLVCFFVPYFTYQGSDTDIFAFGNPLNTAALFIVLLHLVIESKSLTWIHLLVII
GSILSYFLFAIVFGAMCVTCNPPSNPYWIMQEHMLDPVFYLVCILTTSIALLPRFVYRVL
QGSLFPSPILRAKHFDRLTPEERTKALKKWRGAGKMNQVTSKYANQSAGKSGRRPMPGPS
AVFAMKSASSCAIEQGNLSLCETALDQGYSETKAFEMAGPSKGKES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60312	0.781	0.745	0.000	1499	0.493	0.469	O60312.pdb.gz	AT10A_HUMAN Phospholipid-transporting ATPase VA OS=Homo sapiens OX=9606 GN=ATP10A PE=1 SV=2
2	AFDB:O94823	0.801	0.782	0.000	1461	0.507	0.495	O94823.pdb.gz	AT10B_HUMAN Phospholipid-transporting ATPase VB OS=Homo sapiens OX=9606 GN=ATP10B PE=1 SV=2
3	AFDB:Q7KTG6	0.728	0.686	0.000	1517	0.392	0.368	Q7KTG6.pdb.gz	Q7KTG6_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=CG18419 PE=3 SV=1
4	AFDB:Q8K2X1	0.894	0.900	0.000	1416	0.831	0.837	Q8K2X1.pdb.gz	AT10D_MOUSE Phospholipid-transporting ATPase VD OS=Mus musculus OX=10090 GN=Atp10d PE=1 SV=2
5	AFDB:Q9P241	1.000	1.000	0.000	1426	1.000	1.000	Q9P241.pdb.gz	AT10D_HUMAN Phospholipid-transporting ATPase VD OS=Homo sapiens OX=9606 GN=ATP10D PE=1 SV=3
6	AFDB:P98204	0.701	0.859	5.945E-98	1158	0.299	0.368	P98204.pdb.gz	ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=ALA1 PE=2 SV=1
7	AFDB:Q9XIE6	0.710	0.832	2.874E-94	1213	0.297	0.350	Q9XIE6.pdb.gz	ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana OX=3702 GN=ALA3 PE=1 SV=2
8	AFDB:Q9LVK9	0.704	0.803	3.662E-93	1243	0.298	0.342	Q9LVK9.pdb.gz	ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana OX=3702 GN=ALA7 PE=3 SV=3
9	AFDB:Q9SGG3	0.698	0.804	3.480E-91	1228	0.309	0.358	Q9SGG3.pdb.gz	ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana OX=3702 GN=ALA5 PE=3 SV=1
10	AFDB:Q9LNQ4	0.695	0.809	3.710E-90	1216	0.307	0.360	Q9LNQ4.pdb.gz	ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana OX=3702 GN=ALA4 PE=3 SV=2
11	PDB:7kycA	0.664	0.796	8.761E-82	1178	0.290	0.351	7kycA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
12	PDB:7py4A	0.644	0.815	1.015E-78	1112	0.293	0.376	7py4A.pdb.gz	Autoinhibition and regulation by phosphoinositides of ATP8B1, a human lipid flippase associated with intrahepatic cholestatic disorders.
13	PDB:7kyaA	0.662	0.795	1.478E-77	1174	0.293	0.356	7kyaA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
14	PDB:7vghB	0.653	0.780	1.606E-75	1183	0.291	0.351	7vghB.pdb.gz	Structural insights into the activation of autoinhibited human lipid flippase ATP8B1 upon substrate binding.
15	PDB:6rohA	0.667	0.846	2.625E-75	1112	0.280	0.359	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.
16	PDB:6k7lA	0.627	0.887	2.141E-67	992	0.275	0.395	6k7lA.pdb.gz	Cryo-EM structures capture the transport cycle of the P4-ATPase flippase.
17	PDB:7bspA	0.597	0.803	5.331E-66	1028	0.257	0.356	7bspA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
18	PDB:6lknA	0.613	0.805	3.140E-61	1064	0.254	0.340	6lknA.pdb.gz	Crystal structure of a human plasma membrane phospholipid flippase.
19	PDB:7rd6A	0.586	0.875	5.794E-57	929	0.193	0.296	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.
20	PDB:7bssA	0.511	0.867	2.285E-45	816	0.204	0.357	7bssA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60312	0.0	1382	1499	0.494	0.470	AT10A_HUMAN Phospholipid-transporting ATPase VA OS=Homo sapiens OX=9606 GN=ATP10A PE=1 SV=2
2	O94823	0.0	1408	1461	0.504	0.491	AT10B_HUMAN Phospholipid-transporting ATPase VB OS=Homo sapiens OX=9606 GN=ATP10B PE=1 SV=2
3	Q8K2X1	0.0	2467	1416	0.832	0.838	AT10D_MOUSE Phospholipid-transporting ATPase VD OS=Mus musculus OX=10090 GN=Atp10d PE=1 SV=2
4	Q9P241	0.0	2970	1426	1.000	1.000	AT10D_HUMAN Phospholipid-transporting ATPase VD OS=Homo sapiens OX=9606 GN=ATP10D PE=1 SV=3
5	Q7KTG6	9.73e-177	569	1517	0.208	0.196	Q7KTG6_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=CG18419 PE=3 SV=1
6	Q7KTG5	1.08e-176	569	1494	0.208	0.199	Q7KTG5_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=DmCG33298 PE=3 SV=1
7	Q95S66	1.73e-166	513	585	0.186	0.453	Q95S66_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=CG18419 PE=2 SV=1
8	O18182	2.94e-150	495	1411	0.182	0.184	O18182_CAEEL Phospholipid-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=tat-3 PE=1 SV=3
9	Q9XIE6	1.05e-131	440	1213	0.173	0.204	ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana OX=3702 GN=ALA3 PE=1 SV=2
10	A0A5K1VW70	4.99e-131	437	1190	0.177	0.212	A0A5K1VW70_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=1
11	Q8TF62	7.31e-131	437	1192	0.175	0.209	AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens OX=9606 GN=ATP8B4 PE=1 SV=3
12	P98198	8.34e-131	437	1209	0.177	0.208	AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=2
13	P98199	2.49e-130	436	1209	0.178	0.210	AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus OX=10090 GN=Atp8b2 PE=1 SV=2
14	O94296	3.88e-130	436	1258	0.173	0.196	ATC3_SCHPO Phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC887.12 PE=3 SV=1
15	F1LUT4	6.50e-130	429	984	0.173	0.251	F1LUT4_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=4
16	A0A8I6G2I8	6.71e-130	429	978	0.173	0.253	A0A8I6G2I8_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
17	Q9Y2Q0	7.90e-130	433	1164	0.173	0.211	AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens OX=9606 GN=ATP8A1 PE=1 SV=1
18	A0A8I5ZKC1	8.15e-130	429	985	0.173	0.251	A0A8I5ZKC1_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
19	Q9SGG3	1.99e-129	434	1228	0.180	0.208	ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana OX=3702 GN=ALA5 PE=3 SV=1
20	P70704	2.95e-129	432	1164	0.173	0.212	AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus OX=10090 GN=Atp8a1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	1.6e-07	42.6	Cation transport ATPase (P-type)
2	PF00122 E1-E2_ATPase	0.011	26.8	E1-E2 ATPase
3	PF00702 Hydrolase	4.9e-06	38.5	haloacid dehalogenase-like hydrolase
4	PF08282 Hydrolase_3	0.72	21.1	haloacid dehalogenase-like hydrolase
5	PF16212 PhoLip_ATPase_C	4.8e-77	270.7	Phospholipid-translocating P-type ATPase C-terminal
6	PF16209 PhoLip_ATPase_N	5.3e-19	79.0	Phospholipid-translocating ATPase N-terminal
7	PF00558 Vpu	6.3e+02	11.6	Vpu protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273859

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230461	0.886	Cell cycle control protein 50A
2	9606.ENSP00000321038	0.760	Lysoplasmalogenase
3	9606.ENSP00000419663	0.751	Cell cycle control protein 50C
4	9606.ENSP00000399259	0.739	FCH and double SH3 domains 1
5	9606.ENSP00000450842	0.727	Cell cycle control protein 50B
6	9606.ENSP00000371201	0.704	Putative methyltransferase NSUN7
7	9606.ENSP00000371018	0.693	Signal-regulatory protein beta-1
8	9606.ENSP00000425261	0.682	Mitochondrial inner membrane protein COX18
9	9606.ENSP00000248114	0.669	FAD-linked sulfhydryl oxidase ALR
10	9606.ENSP00000363339	0.638	UBX domain-containing protein 11
11	9606.ENSP00000283296	0.626	Adhesion G protein-coupled receptor F5
12	9606.ENSP00000398105	0.614	Glutathione-specific gamma-glutamylcyclotransferase 1
13	9606.ENSP00000360899	0.602	BEN domain-containing protein 5
14	9606.ENSP00000381768	0.568	Cadherin-23
15	9606.ENSP00000327738	0.561	Probable E3 ubiquitin-protein ligase TRIML1
16	9606.ENSP00000411831	0.558	Kinesin-like protein KIF21B
17	9606.ENSP00000305529	0.547	Signal-regulatory protein gamma
18	9606.ENSP00000339179	0.540	Testis-specific serine/threonine-protein kinase 4
19	9606.ENSP00000465099	0.540	DNA-directed RNA polymerase I subunit RPA34
20	9606.ENSP00000458977	0.532	Dipeptidase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140327	1.000	flippase activity
GO:0046624	0.999	sphingolipid transporter activity
GO:0005548	0.980	phospholipid transporter activity
GO:0140333	0.934	glycerophospholipid flippase activity
GO:0008525	0.345	phosphatidylcholine transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0051179	0.967	localization
GO:0006810	0.956	transport
GO:0006811	0.662	monoatomic ion transport
GO:0050789	0.600	regulation of biological process
GO:0055085	0.556	transmembrane transport
GO:0050794	0.544	regulation of cellular process
GO:0034220	0.517	monoatomic ion transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0032991	0.984	protein-containing complex
GO:0005886	0.957	plasma membrane
GO:0043233	0.925	organelle lumen
GO:0070013	0.922	intracellular organelle lumen
GO:1990531	0.909	phospholipid-translocating ATPase complex
GO:0031981	0.906	nuclear lumen
GO:0005654	0.861	nucleoplasm
GO:0005783	0.739	endoplasmic reticulum
GO:0031982	0.428	vesicle
GO:0031090	0.422	organelle membrane
GO:0031410	0.406	cytoplasmic vesicle
GO:0098588	0.366	bounding membrane of organelle
GO:0030659	0.365	cytoplasmic vesicle membrane
GO:0005739	0.308	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.6.2.1	1.000	P-type phospholipid transporter.

[back to server]