StarFunc result for job id Q9P243

User Input

>input (1243 residues)
METRAAENTAIFMCKCCNLFSPNQSELLSHVSEKHMEEGVNVDEIIIPLRPLSTPEPPNS
SKTGDEFLVMKRKRGRPKGSTKKSSTEEELAENIVSPTEDSPLAPEEGNSLPPSSLECSK
CCRKFSNTRQLRKHICIIVLNLGEEEGEAGNESDLELEKKCKEDDREKASKRPRSQKTEK
VQKISGKEARQLSGAKKPIISVVLTAHEAIPGATKIVPVEAGPPETGATNSETTSADLVP
RRGYQEYAIQQTPYEQPMKSSRLGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYK
CPQCSYASAIKANLNVHLRKHTGEKFACDYCSFTCLSKGHLKVHIERVHKKIKQHCRFCK
KKYSDVKNLIKHIRDAHDPQDKKVKEALDELCLMTREGKRQLLYDCHICERKFKNELDRD
RHMLVHGDKWPFACELCGHGATKYQALELHVRKHPFVYVCAVCRKKFVSSIRLRTHIKEV
HGAAQEALVFTSSINQSFCLLEPGGDIQQEALGDQLQLVEEEFALQGVNALKEEACPGDT
QLEEGRKEPEAPGEMPAPAVHLASPQAESTALPPCELETTVVSSSDLHSQEVVSDDFLLK
NDTSSAEAHAAPEKPPDMQHRSSVQTQGEVITLLLSKAQSAGSDQESHGAQSPLGEGQNM
AVLSAGDPDPSRCLRSNPAEASDLLPPVAGGGDTITHQPDSCKAAPEHRSGITAFMKVLN
SLQKKQMNTSLCERIRKVYGDLECEYCGKLFWYQVHFDMHVRTHTREHLYYCSQCHYSSI
TKNCLKRHVIQKHSNILLKCPTDGCDYSTPDKYKLQAHLKVHTALDKRSYSCPVCEKSFS
EDRLIKSHIKTNHPEVSMSTISEVLGRRVQLKGLIGKRAMKCPYCDFYFMKNGSDLQRHI
WAHEGVKPFKCSLCEYATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHT
ADGKQFKCTVCDYTAAQKPQLLRHMEQHVSFKPFRCAHCHYSCNISGSLKRHYNRKHPNE
EYANVGTGELAAEVLIQQGGLKCPVCSFVYGTKWEFNRHLKNKHGLKVVEIDGDPKWETA
TEAPEEPSTQYLHITEAEEDVQGTQAAVAALQDLRYTSESGDRLDPTAVNILQQIIELGA
ETHDATALASVVAMAPGTVTVVKQVTEEEPSSNHTVMIQETVQQASVELAEQHHLVVSSD
DVEGIETVTVYTQGGEASEFIVYVQEAMQPVEEQAVEQPAQEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TS63	0.201	0.202	0.000	1237	0.882	0.886	Q7TS63.pdb.gz	ZFAT_MOUSE Zinc finger protein ZFAT OS=Mus musculus OX=10090 GN=Zfat PE=1 SV=2
2	AFDB:A0A1B0GR71	0.131	0.154	1.634E-24	966	0.139	0.179	A0A1B0GR71.pdb.gz	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
3	AFDB:P17020	0.140	0.222	5.360E-22	682	0.126	0.230	P17020.pdb.gz	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
4	AFDB:Q09FC8	0.108	0.209	1.102E-17	603	0.093	0.192	Q09FC8.pdb.gz	ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens OX=9606 GN=ZNF415 PE=1 SV=2
5	AFDB:O75467	0.160	0.309	1.622E-17	553	0.107	0.241	O75467.pdb.gz	Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens OX=9606 GN=ZNF324 PE=2 SV=1
6	AFDB:Q9H9D4	0.137	0.210	5.770E-17	720	0.112	0.193	Q9H9D4.pdb.gz	ZN408_HUMAN Zinc finger protein 408 OS=Homo sapiens OX=9606 GN=ZNF408 PE=1 SV=1
7	AFDB:Q9Y462	0.134	0.193	1.740E-16	761	0.100	0.163	Q9Y462.pdb.gz	ZN711_HUMAN Zinc finger protein 711 OS=Homo sapiens OX=9606 GN=ZNF711 PE=1 SV=2
8	AFDB:Q16600	0.149	0.320	2.326E-15	458	0.088	0.240	Q16600.pdb.gz	ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens OX=9606 GN=ZNF239 PE=1 SV=3
9	AFDB:Q5EXX3	0.093	0.096	2.361E-14	1203	0.147	0.152	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
10	AFDB:Q3ZBY5	0.100	0.204	1.157E-10	466	0.088	0.234	Q3ZBY5.pdb.gz	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
11	PDB:3w5kB	0.048	0.241	3.083E-3	110	0.027	0.309	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7b5lH	0.048	0.089	2.042E-1	423	0.031	0.092	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
13	PDB:4wa6D	0.031	0.071	6.874E-1	415	0.016	0.048	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
14	PDB:5dkaA	0.029	0.199	9.572E-1	96	0.013	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:5khrN	0.036	0.055	1.194	645	0.023	0.043	5khrN.pdb.gz
16	PDB:7ns4b	0.039	0.099	1.408	340	0.035	0.126	7ns4b.pdb.gz	GID E3 ligase supramolecular chelate assembly configures multipronged ubiquitin targeting of an oligomeric metabolic enzyme.
17	PDB:7o4iW	0.026	0.072	1.573	312	0.027	0.109	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
18	PDB:5y36A	0.044	0.042	2.314	1368	0.024	0.022	5y36A.pdb.gz	Structural insights into DNA cleavage activation of CRISPR-Cas9 system
19	PDB:6o9lQ	0.047	0.087	2.314	430	0.039	0.114	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
20	PDB:6eu0P	0.044	0.098	2.445	298	0.023	0.097	6eu0P.pdb.gz	Structural basis of RNA polymerase III transcription initiation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7TS63	0.0	2215	1237	0.883	0.887	ZFAT_MOUSE Zinc finger protein ZFAT OS=Mus musculus OX=10090 GN=Zfat PE=1 SV=2
2	Q9NTW7	2.05e-27	121	645	0.079	0.152	ZF64B_HUMAN Zinc finger protein 64 OS=Homo sapiens OX=9606 GN=ZFP64 PE=1 SV=3
3	Q60821	3.24e-27	122	794	0.071	0.111	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2
4	P51523	5.00e-27	121	738	0.072	0.121	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
5	Q13105	5.66e-27	121	803	0.071	0.110	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
6	O96395	7.17e-27	119	583	0.072	0.153	O96395_DROME LD05664p OS=Drosophila melanogaster OX=7227 GN=Meics PE=2 SV=2
7	Q8N1W2	1.04e-26	119	664	0.078	0.146	ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens OX=9606 GN=ZNF710 PE=1 SV=2
8	M9PF60	1.13e-26	119	571	0.072	0.156	M9PF60_DROME Meiotic central spindle, isoform B OS=Drosophila melanogaster OX=7227 GN=Meics PE=4 SV=1
9	Q9CXE0	1.27e-26	119	599	0.068	0.142	PRDM5_MOUSE PR domain zinc finger protein 5 OS=Mus musculus OX=10090 GN=Prdm5 PE=2 SV=2
10	F1Q8J8	2.05e-26	118	634	0.068	0.134	F1Q8J8_DANRE PR domain zinc finger protein 5 OS=Danio rerio OX=7955 GN=prdm5 PE=4 SV=1
11	E7FAN3	2.83e-26	119	764	0.064	0.105	E7FAN3_DANRE Zinc finger protein 408 OS=Danio rerio OX=7955 GN=znf408 PE=4 SV=1
12	A0A1Y7VJU7	4.62e-26	115	432	0.075	0.215	A0A1Y7VJU7_MOUSE Pluripotency associated transcript 25 OS=Mus musculus OX=10090 GN=Platr25 PE=4 SV=1
13	A0A1Y7VIZ1	6.84e-26	115	466	0.075	0.200	A0A1Y7VIZ1_MOUSE Pluripotency associated transcript 25 OS=Mus musculus OX=10090 GN=Platr25 PE=4 SV=1
14	A0A1Y7VIS4	7.32e-26	115	464	0.075	0.200	A0A1Y7VIS4_MOUSE Pluripotency associated transcript 25 OS=Mus musculus OX=10090 GN=Platr25 PE=4 SV=1
15	O75467	8.09e-26	115	553	0.068	0.154	Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens OX=9606 GN=ZNF324 PE=2 SV=1
16	Q5T619	9.15e-26	115	568	0.075	0.164	ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens OX=9606 GN=ZNF648 PE=1 SV=1
17	Q96PE6	1.11e-25	114	472	0.065	0.172	ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens OX=9606 GN=ZIM3 PE=1 SV=1
18	Q9UL36	1.87e-25	117	1845	0.064	0.043	ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens OX=9606 GN=ZNF236 PE=1 SV=2
19	Q08705	2.72e-25	115	728	0.061	0.104	CTCF_CHICK Transcriptional repressor CTCF OS=Gallus gallus OX=9031 GN=CTCF PE=1 SV=1
20	Q9H9D4	3.00e-25	115	720	0.068	0.118	ZN408_HUMAN Zinc finger protein 408 OS=Homo sapiens OX=9606 GN=ZNF408 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04423 Rad50_zn_hook	21	16.3	Rad50 zinc hook motif
2	PF00096 zf-C2H2	4.1e-33	123.1	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	6.9e-29	109.0	C2H2-type zinc finger
4	PF06689 zf-C4_ClpX	3.6e+02	12.5	ClpX C4-type zinc finger
5	PF05605 zf-Di19	5.2e-13	60.4	Drought induced 19 protein (Di19), zinc-binding
6	PF13465 zf-H2C2_2	2.3e-36	133.8	Zinc-finger double domain
7	PF13909 zf-H2C2_5	2e-28	109.0	C2H2-type zinc-finger domain
8	PF12874 zf-met	88	14.9	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367069

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251496	0.782	Condensin complex subunit 3
2	9606.ENSP00000371661	0.671	Ligand-dependent nuclear receptor corepressor-like protein
3	9606.ENSP00000396620	0.651	Nuclear transcription factor Y subunit gamma
4	9606.ENSP00000029410	0.618	Beta-1,4-galactosyltransferase 7
5	9606.ENSP00000262225	0.616	Transmembrane emp24 domain-containing protein 2
6	9606.ENSP00000220616	0.614	Thyroglobulin
7	9606.ENSP00000370088	0.602	Amelogenin, X isoform
8	9606.ENSP00000437621	0.589	High mobility group protein HMGI-C
9	9606.ENSP00000383178	0.554	Protein diaphanous homolog 3
10	9606.ENSP00000388684	0.554	Transmembrane protein 247
11	9606.ENSP00000360157	0.553	Forkhead box protein D3
12	9606.ENSP00000265715	0.542	Pendrin
13	9606.ENSP00000318820	0.517	Thyroid peroxidase
14	9606.ENSP00000315203	0.509	Protein CREG2
15	9606.ENSP00000398778	0.508	RELT-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0005515	0.997	protein binding
GO:1901363	0.812	heterocyclic compound binding
GO:0097159	0.812	organic cyclic compound binding
GO:0003676	0.794	nucleic acid binding
GO:0003677	0.739	DNA binding
GO:1990837	0.600	sequence-specific double-stranded DNA binding
GO:0000976	0.538	transcription cis-regulatory region binding
GO:0000977	0.497	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.976	cellular process
GO:0065007	0.949	biological regulation
GO:0032502	0.934	developmental process
GO:0050794	0.895	regulation of cellular process
GO:0048856	0.764	anatomical structure development
GO:0032501	0.738	multicellular organismal process
GO:0060255	0.543	regulation of macromolecule metabolic process
GO:0080090	0.468	regulation of primary metabolic process
GO:0051171	0.434	regulation of nitrogen compound metabolic process
GO:0031323	0.378	regulation of cellular metabolic process
GO:0048518	0.375	positive regulation of biological process
GO:0010468	0.363	regulation of gene expression
GO:0007275	0.355	multicellular organism development
GO:0048522	0.334	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.893	intracellular organelle lumen
GO:0031981	0.880	nuclear lumen
GO:0005654	0.827	nucleoplasm
GO:0005737	0.719	cytoplasm
GO:0016020	0.406	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]